Net::LDAP::FAQ - Frequently Asked Questions about Net::LDAP
Contents
Additional Directory And Ldap Resources.
URLs.
Net::LDAP::Server - LDAP server framework in Perl http://search.cpan.org/search?module=Net::LDAP::Server
https://github.com/alexrj/Net-LDAP-Server
Net::LDAP::SimpleServer - LDAP server in Perl
http://search.cpan.org/search?module=Net::LDAP::SimpleServer
https://github.com/russoz/Net-LDAP-SimpleServer
LemonLDAP::NG - Web SingleSignOn solution & SAML IdP in Perl http://lemonldap-ng.org/
Dancer::Plugin::LDAP - LDAP plugin for Dancer micro framework
http://search.cpan.org/search?module=Dancer::Plugin::LDAP https://github.com/racke/Dancer-Plugin-LDAP
Directory Services Mark Language (DSML) http://www.oasis-open.org/specs/
eMailman LDAP information http://www.emailman.com/ldap/
Rafael Corvalan's LDAP shell http://sf.net/projects/ldapsh
Jeff Hodges's Kings Mountain LDAP http://www.kingsmountain.com/ldapRoadmap.shtml (outdated: last update
was in 2004)
willeke.com's LDAP Wiki http://ldapwiki.willeke.com/wiki/LDAP
OpenLDAP Directory Server - open source LDAP server. http://www.openldap.org/
389 Directory Server - open source LDAP server http://port389.org/
ApacheDS - open source LDAP server in Java http://directory.apache.org/
CriticalPath http://www.cp.net/
ForgeRock's OpenDS - LDAPv3 server with additional REST APIs http://www.forgerock.com/opendj.html
IBM Tivoli Directory Server http://www-01.ibm.com/software/tivoli/products/directory-server/
Isode (was MessagingDirect) http://www.isode.com/
Nexor's X.500 and Internet Directories http://www.nexor.com/info/directory.htm/
Novell's eDirectory http://www.novell.com/
Octet String http://www.octetstring.com/
SUN JAVA JNDI (Java Naming and Directory Interface) http://java.sun.com/products/jndi/overview.html
Oracle Directory Server Enterprise Edition, formerly Sun One, formerly iPlanet.
http://www.oracle.com/technetwork/middleware/id-mgmt/index-085178.html
OptimalIDM - Virtual Identity Server - .NET LDAP virtual directory
http://www.optimalidm.com/products/vis/Virtual-Directory-Server-VDS.aspx
Quest One Quick Connect Virtual Directory Server - LDAP virtual directory
http://www.quest.com/quest-one-quick-connect-virtual-directory-server/
UnboundID's Identity data platform https://www.unboundid.com/
Virtual Directory Blogger https://virtualdirectory.wordpress.com/
eldapo - a directory manager's blog http://eldapo.blogspot.de/
Eine deutsche LDAP Website A German LDAP Website http://verzeichnisdienst.de/ldap/Perl/index.html
(non-exhaustive) list of LDAP software on Wikipedia http://en.wikipedia.org/wiki/List_of_LDAP_software
"RFC Sourcebook" on LDAP http://www.networksorcery.com/enp/protocol/ldap.htm
web2ldap - WWW gateway to LDAP server in Python http://www.web2ldap.de/
Softerra LDAP Browser / Administrator http://www.ldapbrowser.com/
The 2 following URLs deal mainly with Microsoft's Active Directory.
Directory Works http://directoryworks.com/
LDAP Client .Net & ActiveX LDAP Client http://www.ldapservices.com/Products/Default.aspxBOOKS
Developing LDAP and ADSI Clients for Microsoft(R) Exchange. By Sven B. Schreiber. ISBN: 0201657775
Implementing LDAP. By Mark Wilcox. ISBN: 1861002211
LDAP: Programming Directory-Enabled Applications With Lightweight Directory Access Protocol. By Tim
Howes, Mark Smith. ISBN: 1578700000
LDAP Programming; Directory Management and Integration. By Clayton Donley. ISBN: 1884777910
LDAP Programming with Java. By Rob Weltman, Tony Dahbura. ISBN: 0201657589
LDAP System Administration. By Gerald Carter. ISBN: 1565924916
Managing Enterprise Active Directory Services. By Robbie Allen, Richard Puckett. ISBN: 0672321254
Solaris and LDAP Naming Services. By Tom Bialaski, Michael Haines. ISBN: 0-13-030678-9
Understanding and Deploying LDAP Directory Services (2ed). By Tim Howes, Mark Smith, Gordon Good. ISBN:
0672323168
LDAP Directories Explained. By Brian Arkills. ISBN 0-201-78792-X
Copyright
Copyright (c) 1999-2004 Graham Barr, (c) 2012 Peter Marschall. All rights reserved. This document is
distributed, and may be redistributed, under the same terms as Perl itself.
perl v5.32.0 2021-01-03 Net::LDAP::FAQ(3pm)
Description
This document serves to answer the most frequently asked questions on both the perl-ldap Mailing List and
those sent to Graham Barr.
The latest version of this FAQ can be found at
http://ldap.perl.org/FAQ.html
General
Whatisperl-ldap?
perl-ldap is the distribution name. The perl-ldap distribution contains the Net::LDAP modules.
WhyanotherPerlLDAPimplementation?
perl-ldap's goal is to be as portable as possible. It does this by being implemented completely in Perl.
So basically anywhere that Perl runs perl-ldap will run. This is not true for other implementations which
require a C compiler.
WherecanIgetit?
Perl-ldap is available from CPAN. You can find the released versions at:
http://search.cpan.org/dist/perl-ldap/Isthereawebpageforperl-ldap?
Yes there is at http://ldap.perl.org/Isthereamailinglist?
Yes there is at perl-ldap@perl.org
You can subscribe to this list by mailing perl-ldap-subscribe@perl.orgIsthemailinglistarchived?
Yes, at http://nntp.perl.org/group/perl.ldap
Archives with messages before we switched to using perl.org can be found at
http://marc.theaimsgroup.com/?l=perl-ldap-dev
There is also an archive of the perl-ldap mailing list at
http://www.xray.mpe.mpg.de/mailing-lists/perl-ldap/
which also has messages from before the move.
Isthereanyonlinedocumentation?
Yes. perl-ldap has online documentation at
http://ldap.perl.org/
which will have the latest documentation available.
Isthereapublicrepository?
Yes, there is a public Git repository at
https://github.com/perl-ldap/perl-ldap
CanIgetperl-ldapfromthepublicGitrepository?
Yes, anyone can pull perl-ldap from the public Git repository on GitHub.
There are several ways this can be done - see below.
CPAN
You can download it from CPAN by following the "Download" link on:
http://search.cpan.org/dist/perl-ldap/
Example;
http://search.cpan.org/CPAN/authors/id/M/MA/MARSCHAP/perl-ldap-0.54.tar.gz
Git - fork on GitHub
If you have an account on GitHub (there's a free variant), you can easily fork the perl-ldap
repository on GitHub. When logged on to GitHub, navigate to the perl-ldap repository
https://github.com/perl-ldap/perl-ldap
and simply click on the "Fork" button near the top-right corner.
Git - clone repository
You can download latest development version of perl-ldap from GitHub by cloning the repository using
the command:
git clone https://github.com/perl-ldap/perl-ldap.git
This command will create a directory named 'perl-ldap' in your current directory containing a local
clone of the repository.
Keeping your local repository in sync with perl-ldap's GitHub repository is easy:
cd perl-ldap
git pull
Web page
Most of the time there is a URL link on the perl-ldap home page on ldap.perl.org that points to the
latest released version of perl-ldap. Due to the fact that humans must update the web page to point
to a new release it sometimes does not get updated as quickly as it should.
WhatisGit?
Git (see http://git-scm.com) is a distributed version control system designed to keep track of source
changes made by groups of developers working on the same files, allowing them to stay in sync with each
other as each individual chooses.
General Questions.
Arethereanyothercodeexamples.
Yes, there is an Examples pod file. To view the pod do the following command; perldoc
Net::LDAP::Examples
There is user contributed software in the contrib directory that is supplied with the perl-ldap
distribution. This is an excellent source of information on how to use the perl-ldap module.
Arethereanyperformanceissueswithperl-ldap?
In the vast majority of use cases (one user has suggested 9 out of 10) there are no performance issues
with perl-ldap.
Where you may wish to use perl-ldap to perform, for example, a very large number of queries (e.g. 10,000)
in succession you may find a noticeable performance difference between perl-ldap and non pure-Perl
modules. This is not because of perl-ldap itself but because of the pure-Perl Convert::ASN1 module that
it depends on.
You should make up your own mind, based upon your own situation (performance requirements, hardware etc.)
as to whether you should use perl-ldap or not. The figures quoted in this answer are only indicative, and
will differ for different people.
CanIcontributePerlscriptsthatuseperl-ldaptothecontribsection?
Any one can submit a Perl script that uses perl-ldap for inclusion in the contrib section. The perl-ldap
maintainers will determiner if the script will be included and will do the initial check in of the script
to the Git repository at https://github.com/perl-ldap/perl-ldap.
There are a couple of requirements for consideration.
You must supply a one line description of your script to be included in the contrib README file.
Inside the script will be the pod documentation for the script. No auxiliary documentation will be
allowed. For examples of how to do this see the tklkup script currently in the contrib section.
Isitpossibletogetacompleteentry,DNandattributeswithoutspecifyingtheattributesname?
Yes, just specify you want a list of no attributes back. The RFC says that this tells the server to
return all readable attributes back (there may be access controls to prevent some from being returned.)
So in the search method, just set (for LDAPv2):
attrs => [ ]
If you are using LDAPv3, you can specify an attribute called "*" instead, which lets you ask for
additional (i.g. operational) attributes in the same search.
attrs => [ "*" ]
To get all operational attributes in a search, some servers allow the use of the "+" pseudo attribute. So
that with these servers
attrs => [ "*", "+" ]
will return the most information from the server.
HowdoIputaJPEGphotointoaentryinthedirectory?
Follow the following code example, replacing the (...) with whatever is relevant to your setup.
use Net::LDAP;
use Net::LDAP::Util qw(ldap_error_text);
use CGI;
local $/ = undef;
my $jpeg = <$filename>;
my $ldap = Net::LDAP->new(...);
my $res = $ldap->bind(...);
$res = $ldap->modify(...,
add => [ 'jpegPhoto' => [ $jpeg ] ]);
$res = $ldap->unbind();
HowdoIaddajpegphotointoaentryinthedirectoryviahtml-forms?
Follow the following code example, replacing the (...) with whatever is relevant to your setup.
use Net::LDAP;
use Net::LDAP::Util qw(ldap_error_text);
use CGI;
my $q = new CGI;
print $q->header;
print $q->start_html(-title => 'Change JPEG photo');
if ($q->param('Update')) {
my $filename = $q->param('jpeg');
local $/ = undef;
my $jpeg = <$filename>;
my $ldap = Net::LDAP->new(...);
my $res = $ldap->bind(...);
$res = $ldap->modify(...,
add => [ 'jpegPhoto' => [ $jpeg ] ]);
$res = $ldap->unbind();
} else {
print $q->start_multipart_form();
print $q->filefield(-name => 'jpeg', -size => 50);
print $q->submit('Update');
print $q->end_form();
}
print $q->end_html();
Whathappenswhenyoudeleteanattributethatdoesnotexist?
It is an error to delete an attribute that doesn't exist. When you get the error back the server ignores
the entire modify operation you sent it, so you need to make sure the error doesn't happen.
Another approach, if you are using LDAPv3 (note beginning with version .27 Net::LDAP uses LDAPv3 by
default) is to use a 'replace' with your attribute name and no values. In LDAPv3, this is defined to
always work even if that attribute doesn't exist in the entry.
I.e.:
my $mesg = $ldap->modify( $entry, replace => { %qv_del_arry } );
But make sure you are using LDAPv3, because that is defined to not work in LDAPv2. (A nice
incompatibility between LDAPv2 and LDAPv3.)
HowcanIdeleteareferralfromanLDAPtree?
Since this is a proprietary feature, you will have to check your server's documentation. You might find
that you need to use a control. If there is a control called something like ManageDsaIT, that's the one
you should probably use. For proper operation you will need the oid number for ManageDsaIT;
2.16.840.1.113730.3.4.2 and do not specify a value for type.
The code required will look similar to the following code snippet.
$mesg = $ldap->delete("ref=\"ldap://acme/c=us,o=bricks\",o=clay",
control => {type => "2.16.840.1.113730.3.4.2"} );
HowdoIaddanACI/ACLentrytoadirectoryserverwithperl-ldap?
ACIs and ACLs are proprietary features in LDAP. The following code snippet works with a Netscape
directory server. You will need the specify the correct DN (-DN-) and correct attribute(s) (-ATTRNAMEs-).
my $aci = '(target="ldap:///-DN-")(targetattr="-ATTRNAMEs-")(version 3.0;
acl "-ACLNAME-"; deny(all) userdn = "ldap:///self";)' ;
$ldap->modify($dn_modif, add => {'aci' => $aci });
HowdoIavoidfiletypeanddatatypemis-matchingwhenloadingdatafromaWin32system?
When loading a binary attribute with data read from a file on a Win32 system, it has been noted that you
should set "binmode" on the file before reading the file contents into the data array.
Another possible solution to this problem is to convert the binary data into a base64 encoded string and
then store the encoded string in the file. Then when reading the file, decode the base64 encoded string
back to binary and then use perl-ldap to store the data in the directory.
HowdoIcreateanaccountinActiveDirectory?
Active Directory accounts need some AD-specific attributes (only the method we're interested in, no error
checking):
$mesg = $ldap->add( 'cn=John Doe,cn=Users,dc=your,dc=ads,dc=domain',
attrs => [
objectClass => [ qw/top user/ ],
cn => 'John Doe',
sn => 'Doe',
givenName => 'John',
displayName => 'John "the one" Doe',
userAccountControl => 514, # disabled regular user
sAMAccountName => 'JohnDoe',
userPrincipalName => 'JohnDoe@your.ads.domain'
]
);
In order to find out what other attributes can be set, interactively edit the user in the Active
Directory Users and Computers MCC plugin, perform an LDAP search operation to find out what changed, and
update your "add" routine accordingly.
HowcanIcreateagroupinActiveDirectory?
Similar to accounts, groups need some AD-specific attributes too:
$mesg = $ldap->add( 'cn=NewGroup,cn=Users,dc=your,dc=ads,dc=domain',
attrs => [
objectClass => [ qw/top group/ ],
cn => 'NewGroup',
sAMAccountName => 'NewGroup',
groupType => 0x80000002 # global, security enabled group
]
);
HowdoIsearchfordisabledaccountsinActiveDirectory
The bit values in "userAccountControl" require the LDAP_MATCHING_RULE_BIT_AND matching rule's OID to be
used in an extensible filter term:
$mesg = $ldap->search( base => 'cn=Users,dc=your,dc=ads,dc=domain',
filter => '(&(objectclass=user)' .
(userAccountControl:1.2.840.113556.1.4.803:=2))',
attrs => [ '1.1' ]
);
HowcanIsearchforsecuritygroupsinActiveDirectory
With groups, the same applies to the "groupType" bit-field:
$mesg = $ldap->search( base => 'cn=Users,dc=your,dc=ads,dc=domain',
filter => '(&(objectclass=group)' .
(groupType:1.2.840.113556.1.4.803:=2147483648))',
# 2147483648 = 0x80000000
attrs => [ '1.1' ]
);
HowcanIsearchforallmembersofagroupinAD(includinggroupnesting)?
AD allows you to find all members of a specified group, the direct members plus those that are member of
the group via group nesting.
The trick to this is the special "LDAP_MATCHING_RULE_IN_CHAIN" matching rule:
$mesg = $ldap->search( base => 'cn=Users,dc=your,dc=ads,dc=domain',
filter => '(memberOf:1.2.840.113556.1.4.1941:=cn=Testgroup,dc=your,dc=ads,dc=domain)',
attrs => [ '1.1' ]
);
HowcanIsearchforallgroupsoneuserisamemberofinAD(includinggroupnesting)?
Similarly you can search for all the groups one user is member of, either directly or via group nesting.
$mesg = $ldap->search( base => 'dc=your,dc=ads,dc=domain',
filter => '(member:1.2.840.113556.1.4.1941:=cn=TestUser,ou=Users,dc=your,dc=ads,dc=domain)',
attrs => [ '1.1' ]
);
HowdoIsearchforallmembersofalargegroupinAD?
AD normally restricts the number of attribute values returned in one query. The exact number depends on
the AD server version: it was ~1000 in Win2000, 1500 in Win2003 and is 5000 in Win2008 & Win2008R2.
Performing the same standard search again will yield the same values again.
So, how can you get all members of a really large AD group?
The trick to use here is to use Microsoft's rangeoption when searching, i.e instead of doing one search
for plain "member", perform multiple searches for e.g. "member;range=1000-*" where the range starting
index increases accordingly:
my $mesg;
my @members;
my $index = 0;
while ($index ne '*') {
$mesg = $ldap->search( base => 'cn=Testgroup,dc=your,dc=ads,dc=domain',
filter => '(objectclass=group)',
scope => 'base',
attrs => [ ($index > 0) ? "member;range=$index-*" : 'member' ]
);
if ($mesg->code == LDAP_SUCCESS) {
my $entry = $mesg->entry(0);
my $attr;
# large group: let's do the range option dance
if (($attr) = grep(/^member;range=/, $entry->attributes)) {
push(@members, $entry->get_value($attr));
if ($attr =~ /^member;range=\d+-(.*)$/) {
$index = $1;
$index++ if ($index ne '*');
}
}
# small group: no need for the range dance
else {
@members = $entry->get_value('member');
last;
}
}
# failure
else {
last;
}
}
if ($mesg->code == LDAP_SUCCESS) {
# success: @members contains the members of the group
}
else {
# failure: deal with the error in $mesg
}
See <http://msdn.microsoft.com/en-us/library/windows/desktop/aa367017.aspx> for more details.
HowdoIcreateaMicrosoftExchange5.xuser?
This is a solution provided by a perl-ldap user.
This code works with ActiveState Perl running on WinNT 4. Please note that this requires the Win32::Perms
module, and needs valid NT account info to replace the placeholders.
use Net::LDAP;
use Net::LDAP::Util;
use Win32::Perms;
#Constants taken from ADSI Type Library
$ADS_RIGHT_EXCH_ADD_CHILD = 1;
$ADS_RIGHT_EXCH_DELETE = 0x10000;
$ADS_RIGHT_EXCH_DS_REPLICATION = 64;
$ADS_RIGHT_EXCH_DS_SEARCH = 256;
$ADS_RIGHT_EXCH_MAIL_ADMIN_AS = 32;
$ADS_RIGHT_EXCH_MAIL_RECEIVE_AS = 16;
$ADS_RIGHT_EXCH_MAIL_SEND_AS = 8;
$ADS_RIGHT_EXCH_MODIFY_ADMIN_ATT = 4;
$ADS_RIGHT_EXCH_MODIFY_SEC_ATT = 128;
$ADS_RIGHT_EXCH_MODIFY_USER_ATT = 2;
$EXCH_USER_RIGHTS = $ADS_RIGHT_EXCH_MAIL_RECEIVE_AS |
$ADS_RIGHT_EXCH_MAIL_SEND_AS |
$ADS_RIGHT_EXCH_MODIFY_USER_ATT;
$exch = Net::LDAP->new('server', debug =>0) || die $@;
$exch->bind( 'cn=admin_user,cn=nt_domain,cn=admin', version =>3,
password=>'password');
$myObj = Win32::Perms->new();
$Result = $myObj->Owner('nt_domain\user_name');
$myObj->Group('nt_domain\Everyone');
$myObj->Allow('nt_domain\user_name',
$EXCH_USER_RIGHTS,OBJECT_INHERIT_ACE);
$BinarySD = $myObj->GetSD(SD_RELATIVE);
$TextSD = uc(unpack( "H*", $BinarySD ));
Win32::Perms::ResolveSid('nt_domain\user_name', $sid);
$mysid = uc(unpack("H*",$sid));
$result = $exch->add ( dn =>
'cn=user_name,cn=container,ou=site,o=organisation',
attr => [ 'objectClass' => ['organizationalPerson'],
'cn' => 'directory_name',
'uid' => 'mail_nickname',
'mail' => 'smtp_address',
'assoc-nt-account' => [ $mysid ],
'nt-security-descriptor' => [ $TextSD ],
'mailPreferenceOption' => 0
]
);
print ldap_error_name($result->code);
HowdoIresetauser'spassword......inmostLDAPservers?
Most LDAP servers use the standard userPassword attribute as the attribute to set when you want to change
a user's password.
They usually allow one to set the password either using the regular modify operation on the userPassword
attribute or using the extended LDAP Password Modify operation defined in RFC3062.
The recommended method is the extended Password Modify operation, which offers a standardized way to set
user passwords but unfortunately is not available on all LDAP servers.
Whether the extended Password Modify operation is available can be found out by searching the attribute
supportedExtension for the value 1.3.6.1.4.1.4203.1.11.1 in the RootDSE object.
If the extended Password Modify operation is not available the alternative is the regular modification of
the userPassword attribute.
But this method has some drawbacks:
• Depending on the type of the server the arguments to the modify operations may vary. Some want the
modify done with replace, some want it done by explicitly deleting the old password and add of the
new one. This may even depend on whether you change the password for the bound user or as an
administrator for another user.
• With the modify operation some servers expect the client to do the hashing of the password on the
client side. I.e. all clients that set passwords need to agree on the algorithm and the format of the
hashed password.
• Some LDAP servers do not allow setting the password if the connection is not sufficiently secured.
I.e. require SSL or TLS support to set the password (which is heavily recommended anyway ;-)
Here is an example of how to change your own password (for brevity's sake error checking is left out):
use Net::LDAP;
my $ldap = Net::LDAP->new('ldaps://server.domain') or die "$@";
my $mesg = $ldap->bind('cn=Joe User,dc=perl,dc=ldap,dc=org',
password => 'oldPW');
my $rootdse = $ldap->root_dse();
if ($rootdse->supported_extension('1.3.6.1.4.1.4203.1.11.1')) {
require Net::LDAP::Extension::SetPassword;
$mesg = $ldap->set_password(user => 'cn=Joe User,dc=perl,dc=ldap,dc=org',
oldpasswd => 'oldPW',
newpasswd => 'newPW');
}
else {
$mesg = $ldap->modify('cn=Joe User,dc=perl,dc=ldap,dc=org',
changes => [
delete => [ userPassword => $oldPW ]
add => [ userPassword => $newPW ] ]);
}
$ldap->unbind();
...inMSActiveDirectory?
With Active Directory a user's password is stored in the unicodePwd attribute and changed using the
regular modify operation.
ADS expects this password to be encoded in Unicode - UTF-16 to be exact. Before the Unicode conversion
is done the password needs to be surrounded by double quotes which do not belong to the user's password.
For the password modify operation to succeed SSL is required.
When changing the password for the user bound to the directory ADS expects it to be done by deleting the
old password and adding the new one. When doing it as a user with administrative privileges replacing
the unicodePwd's value with a new one is allowed too.
Perl-ldap contains convenience methods for Active Directory that allow one to perform this task very
easily.
Here's an example that demonstrates setting your own password from $oldPW to $newPW (again almost no
error checking):
use Net::LDAP;
use Net::LDAP::Extra qw(AD);
my $ldap = Net::LDAP->new('ldaps://ads.domain.controller') or die "$@";
my $mesg = $ldap->bind('cn=Joe User,dc=your,dc=ads,dc=domain',
password => $oldPW);
$mesg = $ldap->change_ADpassword('cn=Joe User,dc=your,dc=ads,dc=domain',
$oldPW, $newPW);
$ldap->unbind();
And the same for perl-ldap versions before 0.49, where everything needs to be done by hand:
use Net::LDAP;
use Unicode::Map8;
use Unicode::String qw(utf16);
# build the conversion map from your local character set to Unicode
my $charmap = Unicode::Map8->new('latin1') or die;
# surround the PW with double quotes and convert it to UTF-16
# byteswap() was necessary in experiments on i386 Linux, YMMV
my $oldUniPW = $charmap->tou('"'.$oldPW.'"')->byteswap()->utf16();
my $newUniPW = $charmap->tou('"'.$newPW.'"')->byteswap()->utf16();
my $ldap = Net::LDAP->new('ldaps://ads.domain.controller') or die "$@";
my $mesg = $ldap->bind('cn=Joe User,dc=your,dc=ads,dc=domain',
password => $oldPW);
$mesg = $ldap->modify('cn=Joe User,dc=your,dc=ads,dc=domain',
changes => [
delete => [ unicodePwd => $oldUniPW ]
add => [ unicodePwd => $newUniPW ] ]);
$ldap->unbind();
HowcanIsimulateserverfailover?
Perl-ldap does not do server failover, however there are several programming options for getting around
this situation.
Here is one possible solution:
$ldaps = Net::LDAPS->new([ $ldapserverone, $ldapservertwo ],
port=>636, timeout=>5) or die "$@";
For perl-ldap versions before 0.27, the same goal can be achieved using:
unless ( $ldaps =
Net::LDAPS->new($ldapserverone,
port=>636,timeout=>5) )
{
$ldaps = Net::LDAPS->new($ldapservertwo,
port=>636,timeout=>20) ||
return
"Can't connect to $ldapserverone or $ldapservertwo via LDAPS: $@";
}
Getting Search Results
There are two ways of retrieving the results of a requested LDAP search; inline and by using a callback
subroutine.
USINGTHEINLINEAPPROACH
Using the inline approach involves requesting the data and then waiting for all of the data to be
returned before the user starts processing the data.
Example:
use Net::LDAP;
$ldap = Net::LDAP->new('ldap.acme.com') or die "$@";
$mesg = $ldap->search(
base => "o=acme.com",
scope => 'sub',
filter => "sn=smith",
);
#
# At this point the user can get the returned data as an array
# or as a stack.
# In this example we will use an array
# How many entries were returned from the search
my $max = $mesg->count;
for (my $index = 0 ; $index < $max ; $index++)
{
my $entry = $mesg->entry($index);
my $dn = $entry->dn; # Obtain DN of this entry
@attrs = $entry->attributes; # Obtain attributes for this entry.
foreach my $var (@attrs)
{
#get a list of values for a given attribute
$attr = $entry->get_value( $var, asref => 1 );
if ( defined($attr) )
{
foreach my $value ( @$attr )
{
print "$var: $value\n"; # Print each value for the attribute.
}
}
}
}
As you can see the example is straightforward, but there is one drawback to this approach. You must wait
until all entries for the request search to be returned before you can process the data. If there
several thousand entries that match the search filter this could take quite a long time period.
USINGTHECALLBACKSUBROUTINEAPPROACH
Using the callback approach involves requesting the data be sent to a callback subroutine as each entry
arrives at the client.
A callback is just a subroutine that is passed two parameters when it is called, the mesg and entry
objects.
Example:
use Net::LDAP;
$ldap = Net::LDAP->new('ldap.acme.com') or die "$@";
$mesg = $ldap->search(
base => "o=acme.com",
scope => 'sub',
filter => "sn=smith",
callback => \&callback,
);
#
# At this point the user needs to check the status of the
# ldap search.
#
if ( $mesg->code )
{
$errstr = $mesg->code;
print "Error code: $errstr\n";
$errstr = ldap_error_text($errstr);
print "$errstr\n";
}
sub callback
{
my ( $mesg, $entry) = @_;
#
# First you must check to see if something was returned.
# Last execution of callback subroutine will have no
# defined entry and mesg object
#
if ( !defined($entry) )
{
print "No records found matching filter $match.\n"
if ($mesg->count == 0) ; # if mesg is not defined nothing will print.
return;
}
my $dn = $entry->dn; # Obtain DN of this entry
@attrs = $entry->attributes; # Obtain attributes for this entry.
foreach my $var (@attrs)
{
#get a list of values for a given attribute
$attr = $entry->get_value( $var, asref => 1 );
if ( defined($attr) )
{
foreach my $value ( @$attr )
{
print "$var: $value\n"; # Print each value for the attribute.
}
}
}
#
# For large search requests the following line of code
# may be very important, it will reduce the amount of memory
# used by the search results.
#
# If the user is not worried about memory usage then the line
# of code can be omitted.
#
$mesg->pop_entry;
} # End of callback subroutine
As you can see the example is straightforward and it does not waste time waiting for all of the entries
to be returned. However if the pop_entry method is not used the callback approach can allocate a lot of
memory to the search request.
Ldap And Directory Terminology.
In order to help the user understand the perl-ldap module better some key LDAP terminology is defined
here.
Whatisadirectory?
A directory is a special purpose hierarchical database that usually contains typed information such as
text strings, binary data, or X.509 certificates.
WhatisLDAP?
LDAP stands for Lightweight Directory Access Protocol. The word Protocol is the key word in the
definition given in the preceding sentence, LDAP is NOT hardware or software. It is a protocol that
defines how a client and server will communicate with one another.
The Lightweight Directory Access Protocol is defined in a series of Requests For Comments, better known
as RFCs. The RFCs can be found on the Internet at http://www.ietf.org/ (the master repository) and many
other places. There's a link to all the LDAP-related RFCs at perl-ldap's web site,
http://ldap.perl.org/rfc.html. Some of the more important RFC numbers are RFC 4510 - 4519 for LDAP
(previously called LDAPv3) and the historic RFC 1777 for LDAPv2.
WhatisaLDAPDirectory?
In the strictest terms of the definition there is no such thing as a LDAP directory. To be practical
about this situation every day directory professionals refer to their directory as " a LDAP directory"
because it is easy to say and it does convey the type of protocol used to communicate with their
directory. Using this definition a LDAP directory is a directory whose server software conforms to the
Lightweight Directory Access Protocol when communicating with a client.
WhatisanEntry?
The traditional directory definition of a directory object is called an Entry. Entries are composed of
attributes that contain the information to be recorded about the object.
(An entry in LDAP is somewhat analogous to a record in a table in an SQL database, but don't get too hung
up about this analogy!)
Entries are held in an upside-down tree structure. Entries can therefore contain subordinate entries, and
entries must have one direct superior entry.
Entries with subordinate entries are called 'non-leaf' entries.
Entries without subordinate entries are called 'leaf' entries.
An entry's direct superior entry is called the entry's 'parent'.
'Non-leaf' entries are also said to have 'child' entries.
Whatisanattribute?
The entry(s) in a directory are composed of attributes that contain information about the object. Each
attribute has a type and can contain one or more values.
For example:
cn=Road Runner
is an attribute with a type named "cn", and one value.
Each attribute is described by a 'syntax' which defines what kind of information can be stored in the
attributes values. Trying to store a value that doesn't conform to the attribute's syntax will result in
an error.
For example:
jpegPhoto=unknown
is not permitted by the directory, because jpegPhotos may only contain JPEG-formatted images.
Most syntaxes used in LDAP however describe text strings rather than binary objects (like JPEGs or
certificates.)
In LDAPv3 most of these syntaxes support Unicode encoded using UTF-8. Because the Net::LDAP modules do
not change the strings that you pass in as attribute values (they get sent to the LDAP server as-is) to
use accented characters you simply need to encode your strings in UTF-8. There are modules on CPAN that
will help you here.
Note that LDAPv2 servers used something called T.61 instead of Unicode and UTF-8. Most servers do not
implement T.61 correctly, and it is recommended that you use LDAPv3 instead.
Attributes may also be searched. The algorithms used to perform different kinds of searches are
described by the attribute's 'matching rules'. Some matching rules are case-sensitive and some are case-
insensitive, for example. Sometimes matching rules aren't defined for a particular attribute: there's no
way to search for jpegPhotos that contain a substring!
You can examine all of a server's attribute definitions by reading the schema from the server.
Whatisanobjectclass?
An object class is the name associated with a group of attributes that must be present in an entry, and
the group of attributes that may also be present in an entry.
Object classes may be derived (subclassed) from other object classes. For example the widely used
'inetOrgPerson' object class is derived from 'organizationalPerson', which is itself derived from
'person' which is itself derived from 'top'.
Every entry has an attribute called 'objectClass' that lists all the names of object classes (and their
superclasses) being used with the entry.
You can examine all of a server's objectclass definitions by reading the schema from the server.
WhatisaDistinguishedName(DN)?
Every entry in a directory has a Distinguished Name, or DN. It is a unique Entry identifier throughout
the complete directory. No two Entries can have the same DN within the same directory.
Examples of DNs:
cn=Road Runner, ou=bird, dc=cartoon, dc=com
ou=bird, dc=cartoon, dc=com
dc=cartoon, dc=com
dc=com
WhatisaRelativeDistinguishedName?
Every DN is made up of a sequence of Relative Distinguished Names, or RDNs. The sequences of RDNs are
separated by commas (,). In LDAPv2 semi-colons (;) were also allowed. There can be more than one
identical RDN in a directory, but they must have different parent entries.
Technically, an RDN contains attribute-value assertions, or AVAs. When an AVA is written down, the
attribute name is separated from the attribute value with an equals (=) sign.
Example of a DN:
cn=Road Runner,ou=bird,dc=cartoon,dc=com
RDNs of the proceeding DN:
RDN => cn=Road Runner
RDN => ou=bird
RDN => dc=cartoon
RDN => dc=com
RDNs can contain multiple attributes, though this is somewhat unusual. They are called multi-AVA RDNs,
and each AVA is separated in the RDN from the others with a plus sign (+).
Example of a DN with a multi-AVA RDN:
cn=Road Runner+l=Arizona,ou=bird,dc=cartoon,dc=com
Whereisanentry'snameheld?
Entries do not contain their DN. When you retrieve an entry from a search, the server will tell you the
DN of each entry.
On the other hand, entries do contain their RDN. Recall that the RDN is formed from one or more
attribute-value assertions (AVAs); each entry must contain all the attributes and values in the RDN.
For example the entry:
cn=Road Runner+l=Arizona,ou=bird,dc=cartoon,dc=com
must contain a 'cn' attribute containing at least the value "Road Runner", and an 'l' attribute
containing at least the value "Arizona".
The attributes used in the RDN may contain additional values, but the entry still only has one DN.
Whatisasearchbase?
A search base is a Distinguished Name that is the starting point of search queries.
Example of a DN:
cn=Road Runner,ou=bird,dc=cartoon,dc=com
Possible search base(s) for the proceeding DN:
Base => cn=Road Runner,ou=bird,dc=cartoon,dc=com
Base => ou=bird,dc=cartoon,dc=com
Base => dc=cartoon,dc=com
Base => dc=com
Setting the search base to the lowest possible branch of the directory will speed up searches
considerably.
WhatisthedifferencebetweenaLDAPserverandarelationaldatabase?
The most basic difference is that a directory server is a specialized database designed to provide fast
searches. While a relational database is optimized for transactions (where a series of operations is
counted as 1, thus if one of the steps fails, the RDBMS can roll-back to the state it was in before you
started).
Directories also typically are hierarchical in nature (RDBMS is typically flat, but you can implement a
hierarchy using tables and queries), networkable, distributed and replicated.
LDAP provides an open-standard to a directory service.
Typically we use LDAP for email directories (all popular email clients provide an LDAP client now) and
authorization services (authentication and access control).
You could use a RDBMS for these types of queries but there's no set standard, in particular over TCP/IP
to connect to databases over the network. There's language specific protocols (like Perl's DBI and Java's
JDBC) that hide this problem behind an API abstraction, but that's not a replacement for a standard
access protocol.
LDAP is starting to be used on roles traditionally played by RDBMS in terms of general data management
because it's easier to setup a LDAP server (once you understand the basic nomenclature) and you don't
need a DBA to write your queries and more importantly all LDAP servers speak the same essential protocol,
thus you don't have to fuss with a database driver trying to connect it to the Internet. Once you have an
LDAP server up and running, it's automatically available over the 'net. It's possible to connect to a
LDAP server from a variety of mechanisms, including just about every possible programming language.
More information on this topic can be found on the following URLs;
http://www.openldap.org/faq/data/cache/378.htmlhttp://www.isode.com/whitepapers/ic-6055.htmlWhatisthedifferencebetweenaldapreferenceandaldapreferral?
A referral is returned when the entire operation must be resent to another server.
A continuation reference is returned when part of the operation must be resent to another server.
See RFC 4511 section 4.5.3 for more details.
Name
Net::LDAP::FAQ - Frequently Asked Questions about Net::LDAP
Perl-Ldap Installation
HowdoIinstallperl-ldap?
To install the modules that are in the perl-ldap distribution follow the same steps that you would for
most other distributions found on CPAN, that is
# replace 0.62 with the version you have
gunzip perl-ldap-0.62.tar.gz
tar xvf perl-ldap-0.62.tar
cd perl-ldap-0.62
perl Makefile.PL
make
make test
make install
ButIdonothavemake,howcanIinstallperl-ldap?
Well as luck would have it the modules in perl-ldap do not do anything complex, so a simple copy is
enough to install. First run
perl -V
This will output information about the version of Perl you have installed. Near the bottom you will find
something like
@INC:
/usr/local/lib/perl/5.18.2
/usr/local/share/perl/5.18.2
/usr/lib/perl5
/usr/share/perl5
/usr/lib/perl/5.18
/usr/share/perl/5.18
/usr/local/lib/site_per
This is a list of directories that Perl searches when it is looking for a module. The directory you need
is the site_perl directory, but without the system architecture name, in this case it is
"/usr/local/lib/site_perl". The files required can then be installed with
# replace 0.62 with the version you have
gunzip perl-ldap-0.62.tar.gz
tar xvf perl-ldap-0.62.tar
cd perl-ldap-0.62/lib
cp -r * /usr/local/lib/site_perl
HowcanIloadperl-ldapintoanActiveStatePerlinstallation?
There are several ways that perl-ldap can be installed into an ActiveState Perl tree.
1. The ActiveState ppm command can be used to install perl-ldap. When a new version of perl-ldap is
released, it takes ActiveState a period of time to get the new release into the ActiveState ppm
system.
2. If the user has nmake installed, the user can do a normal Perl module install using nmake instead of
make.
3. If the user does not have nmake or make, the user can install perl-ldap using the install-nomake
script by issuing the following command.
perl install-nomake
The install-nomake script can be used on any system that does not have make installed.
WhatothermoduleswillIneed?
perl-ldap uses other Perl modules. Some are required, but some are optional (i.e. required to use certain
features only).
If you are using a Linux system, many of the distributions have packages that you can install using the
distribution's package management tools (e.g. apt, rpm, ...).
Alternatively, you may use your favorite web search engine to find the package that you need.
Convert::ASN1
This module converts between Perl data structures and ASN.1, and is required for perl-ldap to work.
You can obtain the latest release from
http://search.cpan.org/search?module=Convert::ASN1
OpenSSL and IO::Socket::SSL
If you want to use encrypted connections, either via start_tls or LDAPS connections, you will need
this module and the OpenSSL software package.
You can obtain the latest release of IO::Socket::SSL from
http://search.cpan.org/search?module=IO::Socket::SSL
You can obtain the latest release of OpenSSL from
http://www.openssl.org/
IO::Socket::INET6
For connecting to LDAP servers via IPv6, IO::Socket::INET6 is required. Its presence is detected at
runtime, so that perl-ldap can be installed without it, and automatically gains IPv6 support as soon
as IO::Socket::INET6 gets installed.
You can obtain the latest releases from
http://search.cpan.org/search?module=IO::Socket::INET6
IO::Socket::IP
This is an alternative to using IO::Socket::INET6. Like that module, it gets detected automatically
at runtime. If version 0.20 or higher is installed, is is preferred over IO::Socket::INET6 and
IO::Socket::INET for all IP connections.
You can obtain the latest releases from
http://search.cpan.org/search?module=IO::Socket::IP
Authen::SASL
This module is optional. You only need to install Authen::SASL if you want to use the SASL
authentication methods.
You can obtain the latest release from
http://search.cpan.org/search?module=Authen::SASL
Digest::MD5
This module is optional. It also requires a C compiler when installing. You only need to install
Digest::MD5 if you want to use the SASL DIGEST-MD5 authentication mechanism.
You can obtain the latest release from
http://search.cpan.org/search?module=Digest::MD5
As Digest::MD5 is part of the Perl core modules since Perl 5.7.3, you only need a C compiler if you
want to install a version that is newer than the version distributed with your Perl installation.
Digest::HMAC_MD5
This optional module is required only if you want to use the SASL CRAM-MD5 authentication mechanism.
You can obtain the latest release from
http://search.cpan.org/search?module=Digest::HMAC_MD5
GSSAPI
This optional module is required only if you want to use the SASL GSSAPI authentication mechanism
(e.g. for Kerberos authentication).
You can obtain the latest release from
http://search.cpan.org/search?module=GSSAPI
URI::ldap, URI::ldaps, and URI::ldapi
These modules are optional. You only need to install them if you want to parse ldap://, ldaps:// or
ldapi:// URIs using ldap_parse_uri in Net::LDAP::Util. or use LWP::Protocol::ldap,
LWP::Protocol::ldaps, or LWP::Protocol::ldapi.
You can obtain the latest releases from
http://search.cpan.org/search?module=URI::ldap
http://search.cpan.org/search?module=URI::ldaps
http://search.cpan.org/search?module=URI::ldapi
LWP::Protocol, LWP::MediaTypes, HTTP::Negotiate, and HTTP::Response
These optional modules are needed if you want to use perl-ldap's LWP::Protocol::ldap,
LWP::Protocol::ldaps, or LWP::Protocol::ldapi modules.
You can obtain the latest releases from
http://search.cpan.org/search?module=LWP::Protocol
http://search.cpan.org/search?module=LWP::MediaTypes
http://search.cpan.org/search?module=HTTP::Negotiate
http://search.cpan.org/search?module=HTTP::Response
JSON
This optional module is required for JSON-formatted output of perl-ldap's LWP::Protocol::ldap,
LWP::Protocol::ldaps, or LWP::Protocol::ldapi modules.
If you need it, you can obtain the latest releases from
http://search.cpan.org/search?module=JSON
Time::Local
This module is optional, and only required if you want to convert between UNIX time and
generalizedTime using the functions provided in Net::LDAP::Util.
XML::SAX and XML::SAX::Writer
If you want to parse or write DSMLv1 documents with Net::LDAP::DSML to you will need these optional
modules.
You can obtain the latest releases from
http://search.cpan.org/search?module=XML::SAX
http://search.cpan.org/search?module=XML::SAX::Writer
ResourcePool::Factory::Net::LDAP
If you want to use failover the ResourcePool::Factory::Net::LDAP Perl module provides methods to do
this.
You can obtain the latest release from
http://search.cpan.org/search?module=ResourcePool::Factory::Net::LDAP
Synopsis
perldoc Net::LDAP::FAQ
Using Controls And Virtual Lists.
HowdoIaccesstheControlfeatures?
Support for LDAP version 3 Control objects is included in perl-ldap starting with version .20.
For further information and code examples read the Control module documentation; perldoc
Net::LDAP::Control
HowdoIaccesstheVirtualListfeatures?
Support for Virtual Lists is included in perl-ldap starting with version .20.
For further information and code examples read the Control module documentation; perldoc
Net::LDAP::Control
Using Dsml.
HowcanIaccessDSMLfeaturesfromperl-ldap?
Directory Service Markup Language (DSML) is the XML standard for representing directory service
information in XML.
Support for DSML is included in perl-ldap starting with version .20.
At the moment this module only reads and writes DSML entry entities. It cannot process any schema
entities because schema entities are processed differently than elements.
Eventually this module will be a full level 2 consumer and producer enabling you to give you full DSML
conformance.
The specification for DSML is at http://www.oasis-open.org/specs/
For further information and code examples read the DSML module documentation; perldoc Net::LDAP::DSML
Using Ldap Groups.
WhatareLDAPgroups?
LDAP groups are object classes that contain an attribute that can store multiple DN values. Two standard
object classes are 'groupOfNames' (which has a 'member' attribute) and 'groupOfUniqueNames' (which has a
'uniqueMember' attribute.)
According to the RFCs a group can be a member of another group, but some LDAP server vendors restrict
this flexibility by not allowing nested groups in their servers.
Two scripts for working with groups are available in the contrib directory. They are isMember.pl and
printMembers.pl.
Howdoyouformatafiltertosearchforentrieswhose'member'attributehasaparticularvalue?
Asking for (member=*) is OK - the directory uses the equality matching rule which is defined for the
member attribute.
Asking for (member=c*) is not OK - there is no defined substring matching rule for the member attribute.
That's because the member values are *not* strings, but distinguished names. There is no substring
matching rule for DNs, see RFC 4519 section 2.7.
What you have to do is get the results of (member=*) and then select the required results from the
returned values. You need to do this using knowledge of the string representation of DNs defined in RFC
4514, which is important because the same DN can have different string representations. So you need to
perform some canonicalization if you want to be correct.
Using Net::Ldap
HowdoIconnecttomyserver?
The connection to the server is created when you create a new Net::LDAP object, e.g.
$ldap = Net::LDAP->new($server);
Net::LDAP->newsometimesreturnsundef,why?
The constructor will return undef if there was a problem connecting to the specified server. Any error
message will be available in $@
WhatistheproperformatofthebindDN?
The DN used to bind to a directory is a FULLY QUALIFIED DN. The exact structure of the DN will depend on
what data has been stored in the server.
The following are valid examples.
uid=clif,ou=People,dc=umich,dc=edu
cn=directory manager,ou=admins,dc=umich,dc=edu
In some servers the following would be a valid fully qualified DN of the directory manager.
cn=directory manager
HowcanItellwhentheserverreturnsanerror,bind()alwaysreturnstrue?
Most methods in Net::LDAP return a Net::LDAP::Message object, or a sub-class of that. This object will
hold the results from the server, including the result code.
So, for example, to determine the result of the bind operation.
$mesg = $ldap->bind( $dn, password => $passwd );
if ( $mesg->code ) {
# Handle error codes here
}
HowcanIsettheLDAPversionofaconnectiontomyLDAPserver?
This is done by adding the version option when connecting or binding to the LDAP server.
For example;
$ldap = Net::LDAP->new( $server, version => 3 );
or
$mesg = $ldap->bind( $dn, password => $passwd, version => 3 );
Valid version numbers are 2 and 3. As of perl-ldap 0.27 the default LDAP version is 3.
Ididasearchonmydirectoryusingthe'search'method.Wheredidtheresultsgo?
Your search results are stored in a 'search object'. Consider the following:
use Net::LDAP;
$ldap = Net::LDAP->new('ldap.acme.com') or die "$@";
$mesg = $ldap->search(
base => "o=acme.com",
filter => "uid=jsmith",
);
$mesg is a search object. It is a reference blessed into the Net::LDAP::Search package. By calling
methods on this object you can obtain information about the result and also the individual entries.
The first thing to check is if the search was successful. This is done with the method $mesg->code. This
method will return the status code that the server returned. A success will yield a zero value, but there
are other values, some of which could also be considered a success. See Net::LDAP::Constant
use Net::LDAP::Util qw(ldap_error_text);
die ldap_error_text($mesg->code)
if $mesg->code;
There are two ways in which you can access the entries. You can access then with an index or you can
treat the container like a stack and shift each entry in turn. For example
# as an array
# How many entries were returned from the search
my $max = $mesg->count;
for (my $index = 0 ; $index < $max ; $index++) {
my $entry = $mesg->entry($index);
# ...
}
# or as a stack
while (my $entry = $mesg->shift_entry) {
# ...
}
In each case $entry is an entry object. It is a reference blessed into the Net::LDAP::Entry package. By
calling methods on this object you can obtain information about the entry.
For example, to obtain the DN for the entry
$dn = $entry->dn;
To obtain the attributes that a given entry has
@attrs = $entry->attributes;
And to get the list of values for a given attribute
@values = $entry->get( 'sn' );
And to get the first of the values for a given attribute
$values = $entry->get( 'cn' );
One thing to remember is that attribute names are case insensitive, so 'sn', 'Sn', 'sN' and 'SN' are all
the same.
So, if you want to print all the values for the attribute 'ou' then this is as simple as
foreach ($entry->get_value( 'ou' )) {
print $_,"\n";
}
Now if you just want to print all the values for all the attributes you can do
foreach my $attr ($entry->attributes) {
foreach my $value ($entry->get_value($attr)) {
print $attr, ": ", $value, "\n";
}
}
HowdoIlimitthescopeofadirectorysearch?
You limit the scope of a directory search by setting the scope parameter of search request. Consider the
following:
use Net::LDAP;
$ldap = Net::LDAP->new('ldap.acme.com') or die "$@";
$mesg = $ldap->search(
base => "o=acme.com",
scope => 'sub',
filter => "uid=jsmith",
);
Values for the scope parameter are as follows.
base
Search only the base object.
one Search the entries immediately below the base object.
sub
subtree
Search the whole tree below (and including) the base object. This is the default.
children
Search the whole subtree below the base object, excluding the base object itself.
Note: children scope requires LDAPv3 subordinate feature extension.
Using Net::Ldaps
UsinganSSLnetworkconnection,howdoIconnecttomyserver?
This class is a subclass of Net::LDAP so all the normal Net::LDAP methods can be used with a Net::LDAPS
object; see the documentation for Net::LDAP to find out how to query a directory server using the LDAP
protocol.
The connection to the server is created when you create a new Net::LDAPS object, e.g.
$ldaps = Net::LDAPS->new($server,
port => '10000',
verify => 'require',
capath => '/usr/local/cacerts/',
);
Starting with version 0.28 perl-ldap also supports URIs in the new method. So, the above can also be
expressed as:
$ldaps = Net::LDAP->new("ldaps://$server",
port => '10000',
verify => 'require',
capath => '/usr/local/cacerts/',
);
There are additional options to the new method with LDAPS URIs and the LDAPS new method and several
additional methods are included in the LDAPS object class.
For further information and code examples read the LDAPS module documentation; perldoc Net::LDAPS
Using X.509 Certificates.
HowdoIstoreX.509certificatesinthedirectory?
The first problem here is that there are many different formats to hold certificates in, for example PEM,
DER, PKCS#7 and PKCS#12. The directory only uses the DER format (more correctly, it only uses the BER
format) which is a binary format.
Your first job is to ensure that your certificates are therefore in DER/BER format. You could use OpenSSL
to convert from PEM like this:
openssl x509 -inform PEM -in cert.pem -outform DER -out cert.der
Consult the OpenSSL documentation to find out how to perform other conversions.
To add a certificate to the directory, just slurp in the DER/BER certificate into a scalar variable, and
add it to the entry's userCertificate attribute. How you do that will depend on which version of LDAP you
are using.
To slurp in the certificate try something like this:
my $cert;
{
local $/ = undef; # Slurp mode
open CERT, "cert.der" or die;
binmode CERT; # for Windows e.a.
$cert = <CERT>;
close CERT;
}
# The certificate is now in $cert
For LDAPv2, because most directory vendors ignore the string representation of certificates defined in
RFC 1778, you should add this value to the directory like this:
$res = $ldap->modify("cn=My User, o=My Company,c=XY",
add => [
'userCertificate' => [ $cert ]
]);
die "Modify failed (" . ldap_error_name($res->code) . ")\n"
if $res->code;
For LDAPv3, you must do this instead:
$res = $ldap->modify("cn=My User, o=My Company, c=XY",
add => [
'userCertificate;binary' => [ $cert ]
]);
die "Modify failed (" . ldap_error_name($res->code) . ")\n"
if $res->code;
Of course, the entry you are trying to add the certificate to must use object classes that permit the
userCertificate attribute, otherwise the modify will fail with an object class violation error. The
inetOrgPerson structural object class permits userCertificates, as does the strongAuthenticationUser
auxiliary object class. Others might also.
HowdoIsearchobjectsbythecontentsofcertificates.
The directory needs to support one or more of the certificate*Match matching rules.
Then using the filter (for certificateExactMatch)
(userCertificate={ serialNumber 1234, issuer "cn=CA,o=TrustCenter" })
allows searching for the objects containing the attribute userCertificate with a certificate matching
these criteria.
Please note that the exact syntax of the values for the serialNumber and the issuer above may depend on
the LDAP server. In any case the example above works with OpenLDAP 2.4.33.
