logo
Free, Micro AI Code Reviews That Run on Git Commit
git-lrc git-lrc GitHub Install Now We'd appreciate a star git-lrc - Free, Micro AI Code Reviews That Run on Git Commit | Product Hunt git-lrc - Free, Micro AI Code Reviews That Run on Git Commit | Product Hunt

Net::LDAP::FAQ - Frequently Asked Questions about Net::LDAP

Additional Directory And Ldap Resources.

URLs. Net::LDAP::Server - LDAP server framework in Perl http://search.cpan.org/search?module=Net::LDAP::Server https://github.com/alexrj/Net-LDAP-Server Net::LDAP::SimpleServer - LDAP server in Perl http://search.cpan.org/search?module=Net::LDAP::SimpleServer https://github.com/russoz/Net-LDAP-SimpleServer LemonLDAP::NG - Web SingleSignOn solution & SAML IdP in Perl http://lemonldap-ng.org/ Dancer::Plugin::LDAP - LDAP plugin for Dancer micro framework http://search.cpan.org/search?module=Dancer::Plugin::LDAP https://github.com/racke/Dancer-Plugin-LDAP Directory Services Mark Language (DSML) http://www.oasis-open.org/specs/ eMailman LDAP information http://www.emailman.com/ldap/ Rafael Corvalan's LDAP shell http://sf.net/projects/ldapsh Jeff Hodges's Kings Mountain LDAP http://www.kingsmountain.com/ldapRoadmap.shtml (outdated: last update was in 2004) willeke.com's LDAP Wiki http://ldapwiki.willeke.com/wiki/LDAP OpenLDAP Directory Server - open source LDAP server. http://www.openldap.org/ 389 Directory Server - open source LDAP server http://port389.org/ ApacheDS - open source LDAP server in Java http://directory.apache.org/ CriticalPath http://www.cp.net/ ForgeRock's OpenDS - LDAPv3 server with additional REST APIs http://www.forgerock.com/opendj.html IBM Tivoli Directory Server http://www-01.ibm.com/software/tivoli/products/directory-server/ Isode (was MessagingDirect) http://www.isode.com/ Nexor's X.500 and Internet Directories http://www.nexor.com/info/directory.htm/ Novell's eDirectory http://www.novell.com/ Octet String http://www.octetstring.com/ SUN JAVA JNDI (Java Naming and Directory Interface) http://java.sun.com/products/jndi/overview.html Oracle Directory Server Enterprise Edition, formerly Sun One, formerly iPlanet. http://www.oracle.com/technetwork/middleware/id-mgmt/index-085178.html OptimalIDM - Virtual Identity Server - .NET LDAP virtual directory http://www.optimalidm.com/products/vis/Virtual-Directory-Server-VDS.aspx Quest One Quick Connect Virtual Directory Server - LDAP virtual directory http://www.quest.com/quest-one-quick-connect-virtual-directory-server/ UnboundID's Identity data platform https://www.unboundid.com/ Virtual Directory Blogger https://virtualdirectory.wordpress.com/ eldapo - a directory manager's blog http://eldapo.blogspot.de/ Eine deutsche LDAP Website A German LDAP Website http://verzeichnisdienst.de/ldap/Perl/index.html (non-exhaustive) list of LDAP software on Wikipedia http://en.wikipedia.org/wiki/List_of_LDAP_software "RFC Sourcebook" on LDAP http://www.networksorcery.com/enp/protocol/ldap.htm web2ldap - WWW gateway to LDAP server in Python http://www.web2ldap.de/ Softerra LDAP Browser / Administrator http://www.ldapbrowser.com/ The 2 following URLs deal mainly with Microsoft's Active Directory. Directory Works http://directoryworks.com/ LDAP Client .Net & ActiveX LDAP Client http://www.ldapservices.com/Products/Default.aspxBOOKS Developing LDAP and ADSI Clients for Microsoft(R) Exchange. By Sven B. Schreiber. ISBN: 0201657775 Implementing LDAP. By Mark Wilcox. ISBN: 1861002211 LDAP: Programming Directory-Enabled Applications With Lightweight Directory Access Protocol. By Tim Howes, Mark Smith. ISBN: 1578700000 LDAP Programming; Directory Management and Integration. By Clayton Donley. ISBN: 1884777910 LDAP Programming with Java. By Rob Weltman, Tony Dahbura. ISBN: 0201657589 LDAP System Administration. By Gerald Carter. ISBN: 1565924916 Managing Enterprise Active Directory Services. By Robbie Allen, Richard Puckett. ISBN: 0672321254 Solaris and LDAP Naming Services. By Tom Bialaski, Michael Haines. ISBN: 0-13-030678-9 Understanding and Deploying LDAP Directory Services (2ed). By Tim Howes, Mark Smith, Gordon Good. ISBN: 0672323168 LDAP Directories Explained. By Brian Arkills. ISBN 0-201-78792-X

Authors

Any good FAQ is made up of many authors, everyone that contributes information to the perl-ldap mail list is a potential author. An attempt to maintain this FAQ is being done by Chris Ridd <chris.ridd@isode.com> and Peter Marschall <peter@adpm.de>. It was previously updated by Clif Harden <charden@pobox.com>. The original author of this FAQ was Graham Barr <gbarr@pobox.com> Please report any bugs, or post any suggestions, to the perl-ldap mailing list <perl-ldap@perl.org>.

Description

This document serves to answer the most frequently asked questions on both the perl-ldap Mailing List and those sent to Graham Barr. The latest version of this FAQ can be found at http://ldap.perl.org/FAQ.html

General

Whatisperl-ldap? perl-ldap is the distribution name. The perl-ldap distribution contains the Net::LDAP modules. WhyanotherPerlLDAPimplementation? perl-ldap's goal is to be as portable as possible. It does this by being implemented completely in Perl. So basically anywhere that Perl runs perl-ldap will run. This is not true for other implementations which require a C compiler. WherecanIgetit? Perl-ldap is available from CPAN. You can find the released versions at: http://search.cpan.org/dist/perl-ldap/Isthereawebpageforperl-ldap? Yes there is at http://ldap.perl.org/Isthereamailinglist? Yes there is at perl-ldap@perl.org You can subscribe to this list by mailing perl-ldap-subscribe@perl.orgIsthemailinglistarchived? Yes, at http://nntp.perl.org/group/perl.ldap Archives with messages before we switched to using perl.org can be found at http://marc.theaimsgroup.com/?l=perl-ldap-dev There is also an archive of the perl-ldap mailing list at http://www.xray.mpe.mpg.de/mailing-lists/perl-ldap/ which also has messages from before the move. Isthereanyonlinedocumentation? Yes. perl-ldap has online documentation at http://ldap.perl.org/ which will have the latest documentation available. Isthereapublicrepository? Yes, there is a public Git repository at https://github.com/perl-ldap/perl-ldap CanIgetperl-ldapfromthepublicGitrepository? Yes, anyone can pull perl-ldap from the public Git repository on GitHub. There are several ways this can be done - see below. CPAN You can download it from CPAN by following the "Download" link on: http://search.cpan.org/dist/perl-ldap/ Example; http://search.cpan.org/CPAN/authors/id/M/MA/MARSCHAP/perl-ldap-0.54.tar.gz Git - fork on GitHub If you have an account on GitHub (there's a free variant), you can easily fork the perl-ldap repository on GitHub. When logged on to GitHub, navigate to the perl-ldap repository https://github.com/perl-ldap/perl-ldap and simply click on the "Fork" button near the top-right corner. Git - clone repository You can download latest development version of perl-ldap from GitHub by cloning the repository using the command: git clone https://github.com/perl-ldap/perl-ldap.git This command will create a directory named 'perl-ldap' in your current directory containing a local clone of the repository. Keeping your local repository in sync with perl-ldap's GitHub repository is easy: cd perl-ldap git pull Web page Most of the time there is a URL link on the perl-ldap home page on ldap.perl.org that points to the latest released version of perl-ldap. Due to the fact that humans must update the web page to point to a new release it sometimes does not get updated as quickly as it should. WhatisGit? Git (see http://git-scm.com) is a distributed version control system designed to keep track of source changes made by groups of developers working on the same files, allowing them to stay in sync with each other as each individual chooses.

General Questions.

Arethereanyothercodeexamples. Yes, there is an Examples pod file. To view the pod do the following command; perldoc Net::LDAP::Examples There is user contributed software in the contrib directory that is supplied with the perl-ldap distribution. This is an excellent source of information on how to use the perl-ldap module. Arethereanyperformanceissueswithperl-ldap? In the vast majority of use cases (one user has suggested 9 out of 10) there are no performance issues with perl-ldap. Where you may wish to use perl-ldap to perform, for example, a very large number of queries (e.g. 10,000) in succession you may find a noticeable performance difference between perl-ldap and non pure-Perl modules. This is not because of perl-ldap itself but because of the pure-Perl Convert::ASN1 module that it depends on. You should make up your own mind, based upon your own situation (performance requirements, hardware etc.) as to whether you should use perl-ldap or not. The figures quoted in this answer are only indicative, and will differ for different people. CanIcontributePerlscriptsthatuseperl-ldaptothecontribsection? Any one can submit a Perl script that uses perl-ldap for inclusion in the contrib section. The perl-ldap maintainers will determiner if the script will be included and will do the initial check in of the script to the Git repository at https://github.com/perl-ldap/perl-ldap. There are a couple of requirements for consideration. You must supply a one line description of your script to be included in the contrib README file. Inside the script will be the pod documentation for the script. No auxiliary documentation will be allowed. For examples of how to do this see the tklkup script currently in the contrib section. Isitpossibletogetacompleteentry,DNandattributeswithoutspecifyingtheattributesname? Yes, just specify you want a list of no attributes back. The RFC says that this tells the server to return all readable attributes back (there may be access controls to prevent some from being returned.) So in the search method, just set (for LDAPv2): attrs => [ ] If you are using LDAPv3, you can specify an attribute called "*" instead, which lets you ask for additional (i.g. operational) attributes in the same search. attrs => [ "*" ] To get all operational attributes in a search, some servers allow the use of the "+" pseudo attribute. So that with these servers attrs => [ "*", "+" ] will return the most information from the server. HowdoIputaJPEGphotointoaentryinthedirectory? Follow the following code example, replacing the (...) with whatever is relevant to your setup. use Net::LDAP; use Net::LDAP::Util qw(ldap_error_text); use CGI; local $/ = undef; my $jpeg = <$filename>; my $ldap = Net::LDAP->new(...); my $res = $ldap->bind(...); $res = $ldap->modify(..., add => [ 'jpegPhoto' => [ $jpeg ] ]); $res = $ldap->unbind(); HowdoIaddajpegphotointoaentryinthedirectoryviahtml-forms? Follow the following code example, replacing the (...) with whatever is relevant to your setup. use Net::LDAP; use Net::LDAP::Util qw(ldap_error_text); use CGI; my $q = new CGI; print $q->header; print $q->start_html(-title => 'Change JPEG photo'); if ($q->param('Update')) { my $filename = $q->param('jpeg'); local $/ = undef; my $jpeg = <$filename>; my $ldap = Net::LDAP->new(...); my $res = $ldap->bind(...); $res = $ldap->modify(..., add => [ 'jpegPhoto' => [ $jpeg ] ]); $res = $ldap->unbind(); } else { print $q->start_multipart_form(); print $q->filefield(-name => 'jpeg', -size => 50); print $q->submit('Update'); print $q->end_form(); } print $q->end_html(); Whathappenswhenyoudeleteanattributethatdoesnotexist? It is an error to delete an attribute that doesn't exist. When you get the error back the server ignores the entire modify operation you sent it, so you need to make sure the error doesn't happen. Another approach, if you are using LDAPv3 (note beginning with version .27 Net::LDAP uses LDAPv3 by default) is to use a 'replace' with your attribute name and no values. In LDAPv3, this is defined to always work even if that attribute doesn't exist in the entry. I.e.: my $mesg = $ldap->modify( $entry, replace => { %qv_del_arry } ); But make sure you are using LDAPv3, because that is defined to not work in LDAPv2. (A nice incompatibility between LDAPv2 and LDAPv3.) HowcanIdeleteareferralfromanLDAPtree? Since this is a proprietary feature, you will have to check your server's documentation. You might find that you need to use a control. If there is a control called something like ManageDsaIT, that's the one you should probably use. For proper operation you will need the oid number for ManageDsaIT; 2.16.840.1.113730.3.4.2 and do not specify a value for type. The code required will look similar to the following code snippet. $mesg = $ldap->delete("ref=\"ldap://acme/c=us,o=bricks\",o=clay", control => {type => "2.16.840.1.113730.3.4.2"} ); HowdoIaddanACI/ACLentrytoadirectoryserverwithperl-ldap? ACIs and ACLs are proprietary features in LDAP. The following code snippet works with a Netscape directory server. You will need the specify the correct DN (-DN-) and correct attribute(s) (-ATTRNAMEs-). my $aci = '(target="ldap:///-DN-")(targetattr="-ATTRNAMEs-")(version 3.0; acl "-ACLNAME-"; deny(all) userdn = "ldap:///self";)' ; $ldap->modify($dn_modif, add => {'aci' => $aci }); HowdoIavoidfiletypeanddatatypemis-matchingwhenloadingdatafromaWin32system? When loading a binary attribute with data read from a file on a Win32 system, it has been noted that you should set "binmode" on the file before reading the file contents into the data array. Another possible solution to this problem is to convert the binary data into a base64 encoded string and then store the encoded string in the file. Then when reading the file, decode the base64 encoded string back to binary and then use perl-ldap to store the data in the directory. HowdoIcreateanaccountinActiveDirectory? Active Directory accounts need some AD-specific attributes (only the method we're interested in, no error checking): $mesg = $ldap->add( 'cn=John Doe,cn=Users,dc=your,dc=ads,dc=domain', attrs => [ objectClass => [ qw/top user/ ], cn => 'John Doe', sn => 'Doe', givenName => 'John', displayName => 'John "the one" Doe', userAccountControl => 514, # disabled regular user sAMAccountName => 'JohnDoe', userPrincipalName => 'JohnDoe@your.ads.domain' ] ); In order to find out what other attributes can be set, interactively edit the user in the Active Directory Users and Computers MCC plugin, perform an LDAP search operation to find out what changed, and update your "add" routine accordingly. HowcanIcreateagroupinActiveDirectory? Similar to accounts, groups need some AD-specific attributes too: $mesg = $ldap->add( 'cn=NewGroup,cn=Users,dc=your,dc=ads,dc=domain', attrs => [ objectClass => [ qw/top group/ ], cn => 'NewGroup', sAMAccountName => 'NewGroup', groupType => 0x80000002 # global, security enabled group ] ); HowdoIsearchfordisabledaccountsinActiveDirectory The bit values in "userAccountControl" require the LDAP_MATCHING_RULE_BIT_AND matching rule's OID to be used in an extensible filter term: $mesg = $ldap->search( base => 'cn=Users,dc=your,dc=ads,dc=domain', filter => '(&(objectclass=user)' . (userAccountControl:1.2.840.113556.1.4.803:=2))', attrs => [ '1.1' ] ); HowcanIsearchforsecuritygroupsinActiveDirectory With groups, the same applies to the "groupType" bit-field: $mesg = $ldap->search( base => 'cn=Users,dc=your,dc=ads,dc=domain', filter => '(&(objectclass=group)' . (groupType:1.2.840.113556.1.4.803:=2147483648))', # 2147483648 = 0x80000000 attrs => [ '1.1' ] ); HowcanIsearchforallmembersofagroupinAD(includinggroupnesting)? AD allows you to find all members of a specified group, the direct members plus those that are member of the group via group nesting. The trick to this is the special "LDAP_MATCHING_RULE_IN_CHAIN" matching rule: $mesg = $ldap->search( base => 'cn=Users,dc=your,dc=ads,dc=domain', filter => '(memberOf:1.2.840.113556.1.4.1941:=cn=Testgroup,dc=your,dc=ads,dc=domain)', attrs => [ '1.1' ] ); HowcanIsearchforallgroupsoneuserisamemberofinAD(includinggroupnesting)? Similarly you can search for all the groups one user is member of, either directly or via group nesting. $mesg = $ldap->search( base => 'dc=your,dc=ads,dc=domain', filter => '(member:1.2.840.113556.1.4.1941:=cn=TestUser,ou=Users,dc=your,dc=ads,dc=domain)', attrs => [ '1.1' ] ); HowdoIsearchforallmembersofalargegroupinAD? AD normally restricts the number of attribute values returned in one query. The exact number depends on the AD server version: it was ~1000 in Win2000, 1500 in Win2003 and is 5000 in Win2008 & Win2008R2. Performing the same standard search again will yield the same values again. So, how can you get all members of a really large AD group? The trick to use here is to use Microsoft's rangeoption when searching, i.e instead of doing one search for plain "member", perform multiple searches for e.g. "member;range=1000-*" where the range starting index increases accordingly: my $mesg; my @members; my $index = 0; while ($index ne '*') { $mesg = $ldap->search( base => 'cn=Testgroup,dc=your,dc=ads,dc=domain', filter => '(objectclass=group)', scope => 'base', attrs => [ ($index > 0) ? "member;range=$index-*" : 'member' ] ); if ($mesg->code == LDAP_SUCCESS) { my $entry = $mesg->entry(0); my $attr; # large group: let's do the range option dance if (($attr) = grep(/^member;range=/, $entry->attributes)) { push(@members, $entry->get_value($attr)); if ($attr =~ /^member;range=\d+-(.*)$/) { $index = $1; $index++ if ($index ne '*'); } } # small group: no need for the range dance else { @members = $entry->get_value('member'); last; } } # failure else { last; } } if ($mesg->code == LDAP_SUCCESS) { # success: @members contains the members of the group } else { # failure: deal with the error in $mesg } See <http://msdn.microsoft.com/en-us/library/windows/desktop/aa367017.aspx> for more details. HowdoIcreateaMicrosoftExchange5.xuser? This is a solution provided by a perl-ldap user. This code works with ActiveState Perl running on WinNT 4. Please note that this requires the Win32::Perms module, and needs valid NT account info to replace the placeholders. use Net::LDAP; use Net::LDAP::Util; use Win32::Perms; #Constants taken from ADSI Type Library $ADS_RIGHT_EXCH_ADD_CHILD = 1; $ADS_RIGHT_EXCH_DELETE = 0x10000; $ADS_RIGHT_EXCH_DS_REPLICATION = 64; $ADS_RIGHT_EXCH_DS_SEARCH = 256; $ADS_RIGHT_EXCH_MAIL_ADMIN_AS = 32; $ADS_RIGHT_EXCH_MAIL_RECEIVE_AS = 16; $ADS_RIGHT_EXCH_MAIL_SEND_AS = 8; $ADS_RIGHT_EXCH_MODIFY_ADMIN_ATT = 4; $ADS_RIGHT_EXCH_MODIFY_SEC_ATT = 128; $ADS_RIGHT_EXCH_MODIFY_USER_ATT = 2; $EXCH_USER_RIGHTS = $ADS_RIGHT_EXCH_MAIL_RECEIVE_AS | $ADS_RIGHT_EXCH_MAIL_SEND_AS | $ADS_RIGHT_EXCH_MODIFY_USER_ATT; $exch = Net::LDAP->new('server', debug =>0) || die $@; $exch->bind( 'cn=admin_user,cn=nt_domain,cn=admin', version =>3, password=>'password'); $myObj = Win32::Perms->new(); $Result = $myObj->Owner('nt_domain\user_name'); $myObj->Group('nt_domain\Everyone'); $myObj->Allow('nt_domain\user_name', $EXCH_USER_RIGHTS,OBJECT_INHERIT_ACE); $BinarySD = $myObj->GetSD(SD_RELATIVE); $TextSD = uc(unpack( "H*", $BinarySD )); Win32::Perms::ResolveSid('nt_domain\user_name', $sid); $mysid = uc(unpack("H*",$sid)); $result = $exch->add ( dn => 'cn=user_name,cn=container,ou=site,o=organisation', attr => [ 'objectClass' => ['organizationalPerson'], 'cn' => 'directory_name', 'uid' => 'mail_nickname', 'mail' => 'smtp_address', 'assoc-nt-account' => [ $mysid ], 'nt-security-descriptor' => [ $TextSD ], 'mailPreferenceOption' => 0 ] ); print ldap_error_name($result->code); HowdoIresetauser'spassword......inmostLDAPservers? Most LDAP servers use the standard userPassword attribute as the attribute to set when you want to change a user's password. They usually allow one to set the password either using the regular modify operation on the userPassword attribute or using the extended LDAP Password Modify operation defined in RFC3062. The recommended method is the extended Password Modify operation, which offers a standardized way to set user passwords but unfortunately is not available on all LDAP servers. Whether the extended Password Modify operation is available can be found out by searching the attribute supportedExtension for the value 1.3.6.1.4.1.4203.1.11.1 in the RootDSE object. If the extended Password Modify operation is not available the alternative is the regular modification of the userPassword attribute. But this method has some drawbacks: • Depending on the type of the server the arguments to the modify operations may vary. Some want the modify done with replace, some want it done by explicitly deleting the old password and add of the new one. This may even depend on whether you change the password for the bound user or as an administrator for another user. • With the modify operation some servers expect the client to do the hashing of the password on the client side. I.e. all clients that set passwords need to agree on the algorithm and the format of the hashed password. • Some LDAP servers do not allow setting the password if the connection is not sufficiently secured. I.e. require SSL or TLS support to set the password (which is heavily recommended anyway ;-) Here is an example of how to change your own password (for brevity's sake error checking is left out): use Net::LDAP; my $ldap = Net::LDAP->new('ldaps://server.domain') or die "$@"; my $mesg = $ldap->bind('cn=Joe User,dc=perl,dc=ldap,dc=org', password => 'oldPW'); my $rootdse = $ldap->root_dse(); if ($rootdse->supported_extension('1.3.6.1.4.1.4203.1.11.1')) { require Net::LDAP::Extension::SetPassword; $mesg = $ldap->set_password(user => 'cn=Joe User,dc=perl,dc=ldap,dc=org', oldpasswd => 'oldPW', newpasswd => 'newPW'); } else { $mesg = $ldap->modify('cn=Joe User,dc=perl,dc=ldap,dc=org', changes => [ delete => [ userPassword => $oldPW ] add => [ userPassword => $newPW ] ]); } $ldap->unbind(); ...inMSActiveDirectory? With Active Directory a user's password is stored in the unicodePwd attribute and changed using the regular modify operation. ADS expects this password to be encoded in Unicode - UTF-16 to be exact. Before the Unicode conversion is done the password needs to be surrounded by double quotes which do not belong to the user's password. For the password modify operation to succeed SSL is required. When changing the password for the user bound to the directory ADS expects it to be done by deleting the old password and adding the new one. When doing it as a user with administrative privileges replacing the unicodePwd's value with a new one is allowed too. Perl-ldap contains convenience methods for Active Directory that allow one to perform this task very easily. Here's an example that demonstrates setting your own password from $oldPW to $newPW (again almost no error checking): use Net::LDAP; use Net::LDAP::Extra qw(AD); my $ldap = Net::LDAP->new('ldaps://ads.domain.controller') or die "$@"; my $mesg = $ldap->bind('cn=Joe User,dc=your,dc=ads,dc=domain', password => $oldPW); $mesg = $ldap->change_ADpassword('cn=Joe User,dc=your,dc=ads,dc=domain', $oldPW, $newPW); $ldap->unbind(); And the same for perl-ldap versions before 0.49, where everything needs to be done by hand: use Net::LDAP; use Unicode::Map8; use Unicode::String qw(utf16); # build the conversion map from your local character set to Unicode my $charmap = Unicode::Map8->new('latin1') or die; # surround the PW with double quotes and convert it to UTF-16 # byteswap() was necessary in experiments on i386 Linux, YMMV my $oldUniPW = $charmap->tou('"'.$oldPW.'"')->byteswap()->utf16(); my $newUniPW = $charmap->tou('"'.$newPW.'"')->byteswap()->utf16(); my $ldap = Net::LDAP->new('ldaps://ads.domain.controller') or die "$@"; my $mesg = $ldap->bind('cn=Joe User,dc=your,dc=ads,dc=domain', password => $oldPW); $mesg = $ldap->modify('cn=Joe User,dc=your,dc=ads,dc=domain', changes => [ delete => [ unicodePwd => $oldUniPW ] add => [ unicodePwd => $newUniPW ] ]); $ldap->unbind(); HowcanIsimulateserverfailover? Perl-ldap does not do server failover, however there are several programming options for getting around this situation. Here is one possible solution: $ldaps = Net::LDAPS->new([ $ldapserverone, $ldapservertwo ], port=>636, timeout=>5) or die "$@"; For perl-ldap versions before 0.27, the same goal can be achieved using: unless ( $ldaps = Net::LDAPS->new($ldapserverone, port=>636,timeout=>5) ) { $ldaps = Net::LDAPS->new($ldapservertwo, port=>636,timeout=>20) || return "Can't connect to $ldapserverone or $ldapservertwo via LDAPS: $@"; }

Ldap And Directory Terminology.

In order to help the user understand the perl-ldap module better some key LDAP terminology is defined here. Whatisadirectory? A directory is a special purpose hierarchical database that usually contains typed information such as text strings, binary data, or X.509 certificates. WhatisLDAP? LDAP stands for Lightweight Directory Access Protocol. The word Protocol is the key word in the definition given in the preceding sentence, LDAP is NOT hardware or software. It is a protocol that defines how a client and server will communicate with one another. The Lightweight Directory Access Protocol is defined in a series of Requests For Comments, better known as RFCs. The RFCs can be found on the Internet at http://www.ietf.org/ (the master repository) and many other places. There's a link to all the LDAP-related RFCs at perl-ldap's web site, http://ldap.perl.org/rfc.html. Some of the more important RFC numbers are RFC 4510 - 4519 for LDAP (previously called LDAPv3) and the historic RFC 1777 for LDAPv2. WhatisaLDAPDirectory? In the strictest terms of the definition there is no such thing as a LDAP directory. To be practical about this situation every day directory professionals refer to their directory as " a LDAP directory" because it is easy to say and it does convey the type of protocol used to communicate with their directory. Using this definition a LDAP directory is a directory whose server software conforms to the Lightweight Directory Access Protocol when communicating with a client. WhatisanEntry? The traditional directory definition of a directory object is called an Entry. Entries are composed of attributes that contain the information to be recorded about the object. (An entry in LDAP is somewhat analogous to a record in a table in an SQL database, but don't get too hung up about this analogy!) Entries are held in an upside-down tree structure. Entries can therefore contain subordinate entries, and entries must have one direct superior entry. Entries with subordinate entries are called 'non-leaf' entries. Entries without subordinate entries are called 'leaf' entries. An entry's direct superior entry is called the entry's 'parent'. 'Non-leaf' entries are also said to have 'child' entries. Whatisanattribute? The entry(s) in a directory are composed of attributes that contain information about the object. Each attribute has a type and can contain one or more values. For example: cn=Road Runner is an attribute with a type named "cn", and one value. Each attribute is described by a 'syntax' which defines what kind of information can be stored in the attributes values. Trying to store a value that doesn't conform to the attribute's syntax will result in an error. For example: jpegPhoto=unknown is not permitted by the directory, because jpegPhotos may only contain JPEG-formatted images. Most syntaxes used in LDAP however describe text strings rather than binary objects (like JPEGs or certificates.) In LDAPv3 most of these syntaxes support Unicode encoded using UTF-8. Because the Net::LDAP modules do not change the strings that you pass in as attribute values (they get sent to the LDAP server as-is) to use accented characters you simply need to encode your strings in UTF-8. There are modules on CPAN that will help you here. Note that LDAPv2 servers used something called T.61 instead of Unicode and UTF-8. Most servers do not implement T.61 correctly, and it is recommended that you use LDAPv3 instead. Attributes may also be searched. The algorithms used to perform different kinds of searches are described by the attribute's 'matching rules'. Some matching rules are case-sensitive and some are case- insensitive, for example. Sometimes matching rules aren't defined for a particular attribute: there's no way to search for jpegPhotos that contain a substring! You can examine all of a server's attribute definitions by reading the schema from the server. Whatisanobjectclass? An object class is the name associated with a group of attributes that must be present in an entry, and the group of attributes that may also be present in an entry. Object classes may be derived (subclassed) from other object classes. For example the widely used 'inetOrgPerson' object class is derived from 'organizationalPerson', which is itself derived from 'person' which is itself derived from 'top'. Every entry has an attribute called 'objectClass' that lists all the names of object classes (and their superclasses) being used with the entry. You can examine all of a server's objectclass definitions by reading the schema from the server. WhatisaDistinguishedName(DN)? Every entry in a directory has a Distinguished Name, or DN. It is a unique Entry identifier throughout the complete directory. No two Entries can have the same DN within the same directory. Examples of DNs: cn=Road Runner, ou=bird, dc=cartoon, dc=com ou=bird, dc=cartoon, dc=com dc=cartoon, dc=com dc=com WhatisaRelativeDistinguishedName? Every DN is made up of a sequence of Relative Distinguished Names, or RDNs. The sequences of RDNs are separated by commas (,). In LDAPv2 semi-colons (;) were also allowed. There can be more than one identical RDN in a directory, but they must have different parent entries. Technically, an RDN contains attribute-value assertions, or AVAs. When an AVA is written down, the attribute name is separated from the attribute value with an equals (=) sign. Example of a DN: cn=Road Runner,ou=bird,dc=cartoon,dc=com RDNs of the proceeding DN: RDN => cn=Road Runner RDN => ou=bird RDN => dc=cartoon RDN => dc=com RDNs can contain multiple attributes, though this is somewhat unusual. They are called multi-AVA RDNs, and each AVA is separated in the RDN from the others with a plus sign (+). Example of a DN with a multi-AVA RDN: cn=Road Runner+l=Arizona,ou=bird,dc=cartoon,dc=com Whereisanentry'snameheld? Entries do not contain their DN. When you retrieve an entry from a search, the server will tell you the DN of each entry. On the other hand, entries do contain their RDN. Recall that the RDN is formed from one or more attribute-value assertions (AVAs); each entry must contain all the attributes and values in the RDN. For example the entry: cn=Road Runner+l=Arizona,ou=bird,dc=cartoon,dc=com must contain a 'cn' attribute containing at least the value "Road Runner", and an 'l' attribute containing at least the value "Arizona". The attributes used in the RDN may contain additional values, but the entry still only has one DN. Whatisasearchbase? A search base is a Distinguished Name that is the starting point of search queries. Example of a DN: cn=Road Runner,ou=bird,dc=cartoon,dc=com Possible search base(s) for the proceeding DN: Base => cn=Road Runner,ou=bird,dc=cartoon,dc=com Base => ou=bird,dc=cartoon,dc=com Base => dc=cartoon,dc=com Base => dc=com Setting the search base to the lowest possible branch of the directory will speed up searches considerably. WhatisthedifferencebetweenaLDAPserverandarelationaldatabase? The most basic difference is that a directory server is a specialized database designed to provide fast searches. While a relational database is optimized for transactions (where a series of operations is counted as 1, thus if one of the steps fails, the RDBMS can roll-back to the state it was in before you started). Directories also typically are hierarchical in nature (RDBMS is typically flat, but you can implement a hierarchy using tables and queries), networkable, distributed and replicated. LDAP provides an open-standard to a directory service. Typically we use LDAP for email directories (all popular email clients provide an LDAP client now) and authorization services (authentication and access control). You could use a RDBMS for these types of queries but there's no set standard, in particular over TCP/IP to connect to databases over the network. There's language specific protocols (like Perl's DBI and Java's JDBC) that hide this problem behind an API abstraction, but that's not a replacement for a standard access protocol. LDAP is starting to be used on roles traditionally played by RDBMS in terms of general data management because it's easier to setup a LDAP server (once you understand the basic nomenclature) and you don't need a DBA to write your queries and more importantly all LDAP servers speak the same essential protocol, thus you don't have to fuss with a database driver trying to connect it to the Internet. Once you have an LDAP server up and running, it's automatically available over the 'net. It's possible to connect to a LDAP server from a variety of mechanisms, including just about every possible programming language. More information on this topic can be found on the following URLs; http://www.openldap.org/faq/data/cache/378.htmlhttp://www.isode.com/whitepapers/ic-6055.htmlWhatisthedifferencebetweenaldapreferenceandaldapreferral? A referral is returned when the entire operation must be resent to another server. A continuation reference is returned when part of the operation must be resent to another server. See RFC 4511 section 4.5.3 for more details.

Name

Net::LDAP::FAQ - Frequently Asked Questions about Net::LDAP

Perl-Ldap Installation

HowdoIinstallperl-ldap? To install the modules that are in the perl-ldap distribution follow the same steps that you would for most other distributions found on CPAN, that is # replace 0.62 with the version you have gunzip perl-ldap-0.62.tar.gz tar xvf perl-ldap-0.62.tar cd perl-ldap-0.62 perl Makefile.PL make make test make install ButIdonothavemake,howcanIinstallperl-ldap? Well as luck would have it the modules in perl-ldap do not do anything complex, so a simple copy is enough to install. First run perl -V This will output information about the version of Perl you have installed. Near the bottom you will find something like @INC: /usr/local/lib/perl/5.18.2 /usr/local/share/perl/5.18.2 /usr/lib/perl5 /usr/share/perl5 /usr/lib/perl/5.18 /usr/share/perl/5.18 /usr/local/lib/site_per This is a list of directories that Perl searches when it is looking for a module. The directory you need is the site_perl directory, but without the system architecture name, in this case it is "/usr/local/lib/site_perl". The files required can then be installed with # replace 0.62 with the version you have gunzip perl-ldap-0.62.tar.gz tar xvf perl-ldap-0.62.tar cd perl-ldap-0.62/lib cp -r * /usr/local/lib/site_perl HowcanIloadperl-ldapintoanActiveStatePerlinstallation? There are several ways that perl-ldap can be installed into an ActiveState Perl tree. 1. The ActiveState ppm command can be used to install perl-ldap. When a new version of perl-ldap is released, it takes ActiveState a period of time to get the new release into the ActiveState ppm system. 2. If the user has nmake installed, the user can do a normal Perl module install using nmake instead of make. 3. If the user does not have nmake or make, the user can install perl-ldap using the install-nomake script by issuing the following command. perl install-nomake The install-nomake script can be used on any system that does not have make installed. WhatothermoduleswillIneed? perl-ldap uses other Perl modules. Some are required, but some are optional (i.e. required to use certain features only). If you are using a Linux system, many of the distributions have packages that you can install using the distribution's package management tools (e.g. apt, rpm, ...). Alternatively, you may use your favorite web search engine to find the package that you need. Convert::ASN1 This module converts between Perl data structures and ASN.1, and is required for perl-ldap to work. You can obtain the latest release from http://search.cpan.org/search?module=Convert::ASN1 OpenSSL and IO::Socket::SSL If you want to use encrypted connections, either via start_tls or LDAPS connections, you will need this module and the OpenSSL software package. You can obtain the latest release of IO::Socket::SSL from http://search.cpan.org/search?module=IO::Socket::SSL You can obtain the latest release of OpenSSL from http://www.openssl.org/ IO::Socket::INET6 For connecting to LDAP servers via IPv6, IO::Socket::INET6 is required. Its presence is detected at runtime, so that perl-ldap can be installed without it, and automatically gains IPv6 support as soon as IO::Socket::INET6 gets installed. You can obtain the latest releases from http://search.cpan.org/search?module=IO::Socket::INET6 IO::Socket::IP This is an alternative to using IO::Socket::INET6. Like that module, it gets detected automatically at runtime. If version 0.20 or higher is installed, is is preferred over IO::Socket::INET6 and IO::Socket::INET for all IP connections. You can obtain the latest releases from http://search.cpan.org/search?module=IO::Socket::IP Authen::SASL This module is optional. You only need to install Authen::SASL if you want to use the SASL authentication methods. You can obtain the latest release from http://search.cpan.org/search?module=Authen::SASL Digest::MD5 This module is optional. It also requires a C compiler when installing. You only need to install Digest::MD5 if you want to use the SASL DIGEST-MD5 authentication mechanism. You can obtain the latest release from http://search.cpan.org/search?module=Digest::MD5 As Digest::MD5 is part of the Perl core modules since Perl 5.7.3, you only need a C compiler if you want to install a version that is newer than the version distributed with your Perl installation. Digest::HMAC_MD5 This optional module is required only if you want to use the SASL CRAM-MD5 authentication mechanism. You can obtain the latest release from http://search.cpan.org/search?module=Digest::HMAC_MD5 GSSAPI This optional module is required only if you want to use the SASL GSSAPI authentication mechanism (e.g. for Kerberos authentication). You can obtain the latest release from http://search.cpan.org/search?module=GSSAPI URI::ldap, URI::ldaps, and URI::ldapi These modules are optional. You only need to install them if you want to parse ldap://, ldaps:// or ldapi:// URIs using ldap_parse_uri in Net::LDAP::Util. or use LWP::Protocol::ldap, LWP::Protocol::ldaps, or LWP::Protocol::ldapi. You can obtain the latest releases from http://search.cpan.org/search?module=URI::ldap http://search.cpan.org/search?module=URI::ldaps http://search.cpan.org/search?module=URI::ldapi LWP::Protocol, LWP::MediaTypes, HTTP::Negotiate, and HTTP::Response These optional modules are needed if you want to use perl-ldap's LWP::Protocol::ldap, LWP::Protocol::ldaps, or LWP::Protocol::ldapi modules. You can obtain the latest releases from http://search.cpan.org/search?module=LWP::Protocol http://search.cpan.org/search?module=LWP::MediaTypes http://search.cpan.org/search?module=HTTP::Negotiate http://search.cpan.org/search?module=HTTP::Response JSON This optional module is required for JSON-formatted output of perl-ldap's LWP::Protocol::ldap, LWP::Protocol::ldaps, or LWP::Protocol::ldapi modules. If you need it, you can obtain the latest releases from http://search.cpan.org/search?module=JSON Time::Local This module is optional, and only required if you want to convert between UNIX time and generalizedTime using the functions provided in Net::LDAP::Util. XML::SAX and XML::SAX::Writer If you want to parse or write DSMLv1 documents with Net::LDAP::DSML to you will need these optional modules. You can obtain the latest releases from http://search.cpan.org/search?module=XML::SAX http://search.cpan.org/search?module=XML::SAX::Writer ResourcePool::Factory::Net::LDAP If you want to use failover the ResourcePool::Factory::Net::LDAP Perl module provides methods to do this. You can obtain the latest release from http://search.cpan.org/search?module=ResourcePool::Factory::Net::LDAP

Synopsis

perldoc Net::LDAP::FAQ

Using Controls And Virtual Lists.

HowdoIaccesstheControlfeatures? Support for LDAP version 3 Control objects is included in perl-ldap starting with version .20. For further information and code examples read the Control module documentation; perldoc Net::LDAP::Control HowdoIaccesstheVirtualListfeatures? Support for Virtual Lists is included in perl-ldap starting with version .20. For further information and code examples read the Control module documentation; perldoc Net::LDAP::Control

Using Dsml.

HowcanIaccessDSMLfeaturesfromperl-ldap? Directory Service Markup Language (DSML) is the XML standard for representing directory service information in XML. Support for DSML is included in perl-ldap starting with version .20. At the moment this module only reads and writes DSML entry entities. It cannot process any schema entities because schema entities are processed differently than elements. Eventually this module will be a full level 2 consumer and producer enabling you to give you full DSML conformance. The specification for DSML is at http://www.oasis-open.org/specs/ For further information and code examples read the DSML module documentation; perldoc Net::LDAP::DSML

Using Ldap Groups.

WhatareLDAPgroups? LDAP groups are object classes that contain an attribute that can store multiple DN values. Two standard object classes are 'groupOfNames' (which has a 'member' attribute) and 'groupOfUniqueNames' (which has a 'uniqueMember' attribute.) According to the RFCs a group can be a member of another group, but some LDAP server vendors restrict this flexibility by not allowing nested groups in their servers. Two scripts for working with groups are available in the contrib directory. They are isMember.pl and printMembers.pl. Howdoyouformatafiltertosearchforentrieswhose'member'attributehasaparticularvalue? Asking for (member=*) is OK - the directory uses the equality matching rule which is defined for the member attribute. Asking for (member=c*) is not OK - there is no defined substring matching rule for the member attribute. That's because the member values are *not* strings, but distinguished names. There is no substring matching rule for DNs, see RFC 4519 section 2.7. What you have to do is get the results of (member=*) and then select the required results from the returned values. You need to do this using knowledge of the string representation of DNs defined in RFC 4514, which is important because the same DN can have different string representations. So you need to perform some canonicalization if you want to be correct.

Using Net::Ldap

HowdoIconnecttomyserver? The connection to the server is created when you create a new Net::LDAP object, e.g. $ldap = Net::LDAP->new($server); Net::LDAP->newsometimesreturnsundef,why? The constructor will return undef if there was a problem connecting to the specified server. Any error message will be available in $@ WhatistheproperformatofthebindDN? The DN used to bind to a directory is a FULLY QUALIFIED DN. The exact structure of the DN will depend on what data has been stored in the server. The following are valid examples. uid=clif,ou=People,dc=umich,dc=edu cn=directory manager,ou=admins,dc=umich,dc=edu In some servers the following would be a valid fully qualified DN of the directory manager. cn=directory manager HowcanItellwhentheserverreturnsanerror,bind()alwaysreturnstrue? Most methods in Net::LDAP return a Net::LDAP::Message object, or a sub-class of that. This object will hold the results from the server, including the result code. So, for example, to determine the result of the bind operation. $mesg = $ldap->bind( $dn, password => $passwd ); if ( $mesg->code ) { # Handle error codes here } HowcanIsettheLDAPversionofaconnectiontomyLDAPserver? This is done by adding the version option when connecting or binding to the LDAP server. For example; $ldap = Net::LDAP->new( $server, version => 3 ); or $mesg = $ldap->bind( $dn, password => $passwd, version => 3 ); Valid version numbers are 2 and 3. As of perl-ldap 0.27 the default LDAP version is 3. Ididasearchonmydirectoryusingthe'search'method.Wheredidtheresultsgo? Your search results are stored in a 'search object'. Consider the following: use Net::LDAP; $ldap = Net::LDAP->new('ldap.acme.com') or die "$@"; $mesg = $ldap->search( base => "o=acme.com", filter => "uid=jsmith", ); $mesg is a search object. It is a reference blessed into the Net::LDAP::Search package. By calling methods on this object you can obtain information about the result and also the individual entries. The first thing to check is if the search was successful. This is done with the method $mesg->code. This method will return the status code that the server returned. A success will yield a zero value, but there are other values, some of which could also be considered a success. See Net::LDAP::Constant use Net::LDAP::Util qw(ldap_error_text); die ldap_error_text($mesg->code) if $mesg->code; There are two ways in which you can access the entries. You can access then with an index or you can treat the container like a stack and shift each entry in turn. For example # as an array # How many entries were returned from the search my $max = $mesg->count; for (my $index = 0 ; $index < $max ; $index++) { my $entry = $mesg->entry($index); # ... } # or as a stack while (my $entry = $mesg->shift_entry) { # ... } In each case $entry is an entry object. It is a reference blessed into the Net::LDAP::Entry package. By calling methods on this object you can obtain information about the entry. For example, to obtain the DN for the entry $dn = $entry->dn; To obtain the attributes that a given entry has @attrs = $entry->attributes; And to get the list of values for a given attribute @values = $entry->get( 'sn' ); And to get the first of the values for a given attribute $values = $entry->get( 'cn' ); One thing to remember is that attribute names are case insensitive, so 'sn', 'Sn', 'sN' and 'SN' are all the same. So, if you want to print all the values for the attribute 'ou' then this is as simple as foreach ($entry->get_value( 'ou' )) { print $_,"\n"; } Now if you just want to print all the values for all the attributes you can do foreach my $attr ($entry->attributes) { foreach my $value ($entry->get_value($attr)) { print $attr, ": ", $value, "\n"; } } HowdoIlimitthescopeofadirectorysearch? You limit the scope of a directory search by setting the scope parameter of search request. Consider the following: use Net::LDAP; $ldap = Net::LDAP->new('ldap.acme.com') or die "$@"; $mesg = $ldap->search( base => "o=acme.com", scope => 'sub', filter => "uid=jsmith", ); Values for the scope parameter are as follows. base Search only the base object. one Search the entries immediately below the base object. sub subtree Search the whole tree below (and including) the base object. This is the default. children Search the whole subtree below the base object, excluding the base object itself. Note: children scope requires LDAPv3 subordinate feature extension.

Using Net::Ldaps

UsinganSSLnetworkconnection,howdoIconnecttomyserver? This class is a subclass of Net::LDAP so all the normal Net::LDAP methods can be used with a Net::LDAPS object; see the documentation for Net::LDAP to find out how to query a directory server using the LDAP protocol. The connection to the server is created when you create a new Net::LDAPS object, e.g. $ldaps = Net::LDAPS->new($server, port => '10000', verify => 'require', capath => '/usr/local/cacerts/', ); Starting with version 0.28 perl-ldap also supports URIs in the new method. So, the above can also be expressed as: $ldaps = Net::LDAP->new("ldaps://$server", port => '10000', verify => 'require', capath => '/usr/local/cacerts/', ); There are additional options to the new method with LDAPS URIs and the LDAPS new method and several additional methods are included in the LDAPS object class. For further information and code examples read the LDAPS module documentation; perldoc Net::LDAPS

Using X.509 Certificates.

HowdoIstoreX.509certificatesinthedirectory? The first problem here is that there are many different formats to hold certificates in, for example PEM, DER, PKCS#7 and PKCS#12. The directory only uses the DER format (more correctly, it only uses the BER format) which is a binary format. Your first job is to ensure that your certificates are therefore in DER/BER format. You could use OpenSSL to convert from PEM like this: openssl x509 -inform PEM -in cert.pem -outform DER -out cert.der Consult the OpenSSL documentation to find out how to perform other conversions. To add a certificate to the directory, just slurp in the DER/BER certificate into a scalar variable, and add it to the entry's userCertificate attribute. How you do that will depend on which version of LDAP you are using. To slurp in the certificate try something like this: my $cert; { local $/ = undef; # Slurp mode open CERT, "cert.der" or die; binmode CERT; # for Windows e.a. $cert = <CERT>; close CERT; } # The certificate is now in $cert For LDAPv2, because most directory vendors ignore the string representation of certificates defined in RFC 1778, you should add this value to the directory like this: $res = $ldap->modify("cn=My User, o=My Company,c=XY", add => [ 'userCertificate' => [ $cert ] ]); die "Modify failed (" . ldap_error_name($res->code) . ")\n" if $res->code; For LDAPv3, you must do this instead: $res = $ldap->modify("cn=My User, o=My Company, c=XY", add => [ 'userCertificate;binary' => [ $cert ] ]); die "Modify failed (" . ldap_error_name($res->code) . ")\n" if $res->code; Of course, the entry you are trying to add the certificate to must use object classes that permit the userCertificate attribute, otherwise the modify will fail with an object class violation error. The inetOrgPerson structural object class permits userCertificates, as does the strongAuthenticationUser auxiliary object class. Others might also. HowdoIsearchobjectsbythecontentsofcertificates. The directory needs to support one or more of the certificate*Match matching rules. Then using the filter (for certificateExactMatch) (userCertificate={ serialNumber 1234, issuer "cn=CA,o=TrustCenter" }) allows searching for the objects containing the attribute userCertificate with a certificate matching these criteria. Please note that the exact syntax of the values for the serialNumber and the issuer above may depend on the LDAP server. In any case the example above works with OpenLDAP 2.4.33.

See Also