Blast-Radius Aware AI Code Review for Business-Critical Systems
LiveReview LiveReview Explore LiveReview

Bio::Tools::Sigcleave - Bioperl object for sigcleave analysis

Appendix

       The following documentation describes the various functions contained in this module. Some functions are
       for internal use and are not meant to be called by the user; they are preceded by an underscore ("_").

Author

       Chris Dagdigian, dag-at-sonsorol.org  & others

Contributors

       Heikki Lehvaslaiho, heikki-at-bioperl-dot-org

Description

       "Sigcleave" was a program distributed as part of the free EGCG add-on to earlier versions of the GCG
       Sequence Analysis package. A new implementation of the algorithm is now part of EMBOSS package.

       From the EGCG documentation:

         SigCleave uses the von Heijne method to locate signal sequences, and
         to identify the cleavage site. The method is 95% accurate in
         resolving signal sequences from non-signal sequences with a cutoff
         score of 3.5, and 75-80% accurate in identifying the cleavage
         site. The program reports all hits above a minimum value.

       The EGCG Sigcleave program was written by Peter Rice (E-mail: pmr@sanger.ac.uk Post: Informatics
       Division, The Sanger Centre, Wellcome Trust Genome Campus, Hinxton, Cambs, CB10 1SA, UK).

       Since EGCG is no longer distributed for the latest versions of GCG, this code was developed to emulate
       the output of the original program as much as possible for those who lost access to sigcleave when
       upgrading to newer versions of GCG.

       There are 2 accessor methods for this object. "signals" will return a perl associative array containing
       the sigcleave scores keyed by amino acid position.  "pretty_print" returns a formatted string similar to
       the output of the original sigcleave utility.

       In both cases, the "threshold" setting controls the score reporting level. If no value for threshold is
       passed in by the user, the code defaults to a reporting value of 3.5.

       In this implementation the accessor will never return any score/position pair which does not meet the
       threshold limit. This is the slightly different from the behaviour of the 8.1 EGCG sigcleave program
       which will report the highest of the under-threshold results if nothing else is found.

       Example of pretty_print output:

               SIGCLEAVE of sigtest from: 1 to 146

               Report scores over 3.5
               Maximum score 4.9 at residue 131

                Sequence:  FVILAAMSIQGSA-NLQTQWKSTASLALET
                           | (signal)    | (mature peptide)
                       118            131

                Other entries above 3.5

               Maximum score 3.7 at residue 112

                Sequence:  CSRQLFGWLFCKV-HPGAIVFVILAAMSIQGSANLQTQWKSTASLALET
                          | (signal)    | (mature peptide)
                       99            112

Feedback

       When updating and maintaining a module, it helps to know that people are actually using it. Let us know
       if you find a bug, think this code is useful or have any improvements/features to suggest.

   Support
       Please direct usage questions or support issues to the mailing list:

       bioperl-l@bioperl.org

       rather than to the module maintainer directly. Many experienced and reponsive experts will be able look
       at the problem and quickly address it. Please include a thorough description of the problem with code and
       data examples if at all possible.

   ReportingBugs
       Report bugs to the Bioperl bug tracking system to help us keep track the bugs and their resolution. Bug
       reports can be submitted via the web:

         https://github.com/bioperl/bioperl-live/issues

Matrix

        Title     : matrix
        Usage     : $value = $self->matrix('procaryotic')
        Purpose   : Read/write method sigcleave matrix.
        Returns   : float.
        Argument  : new value: 'eucaryotic' or 'procaryotic'
        Throws    : on non-number argument
        Comments  : defaults to 3.5
        See Also   : n/a

Name

       Bio::Tools::Sigcleave - Bioperl object for sigcleave analysis

Pretty_Print

        Title     : pretty_print
        Usage     : $output = $sig->pretty_print;
                  : print $sig->pretty_print;
                  :
        Purpose   : Emulates the output of the EGCG Sigcleave
                  : utility.
                  :
        Returns   : A formatted string.
        Argument  : none.
        Throws    : none.
        Comments  : none.
       See Also   : n/a

perl v5.32.1                                       2021-08-15                         Bio::Tools::Sigcleave(3pm)

References / See Also

       von Heijne G. (1986) "A new method for predicting signal sequences cleavage sites."  Nucleic Acids Res.
       14, 4683-4690.

       von Heijne G. (1987) in "Sequence Analysis in Molecular Biology: Treasure Trove or Trivial Pursuit"
       (Acad. Press, (1987), 113-117).

Result_Count

        Title     : result_count
        Usage     : $count = $sig->result_count;
                  :
        Purpose   : Accessor method for sigcleave results
                  :
        Returns   : Integer, number of results above the threshold
                  :
        Argument  : none.
        Throws    : none.
        Comments  : none.

       See Also   : THRESHOLD

Seq

        Title     : seq
        Usage     : $value = $self->seq($seq_object)
        Purpose   : set the Seq object to be used
        Returns   : Seq object
        Argument  : protein sequence or Seq object
        See Also   : n/a

Signals

        Title     : signals
        Usage     : %sigcleave_results = $sig->signals;
                  :
        Purpose   : Accessor method for sigcleave results
                  :
        Returns   : Associative array. The key value represents the amino acid position
                  : and the value represents the score. Only scores that
                  : are greater than or equal to the THRESHOLD value are reported.
                  :
        Argument  : none.
        Throws    : none.
        Comments  : none.
       See Also   : THRESHOLD

Synopsis

ObjectCreation
         use Bio::Tools::Sigcleave ();

         # to keep the module backwar compatible, you can pass it a sequence string, but
         # there recommended say is to pass it a Seq object

         # this works
         $seq = "MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGI";
         $sig = Bio::Tools::Sigcleave->new(-seq  => $seq,
                                                       -type => 'protein',
                                                       -threshold=>'3.5',
                                                       );
         # but you do:
         $seqobj = Bio::PrimarySeq->new(-seq => $seq);

         $sig = Bio::Tools::Sigcleave->new(-seq  => $seqobj,
                                                       -threshold=>'3.5',
                                                       );

         # now you can detect procaryotic signal sequences as well as eucaryotic
         $sig->matrix('eucaryotic'); # or 'procaryotic'

   ObjectMethods&Accessors
         # you can use this method to fine tune the threshod before printing out the results
         $sig->result_count:

         %raw_results      = $sig->signals;
         $formatted_output = $sig->pretty_print;

Threshold

        Title     : threshold
        Usage     : $value = $self->threshold
        Purpose   : Read/write method sigcleave score reporting threshold.
        Returns   : float.
        Argument  : new value, float
        Throws    : on non-number argument
        Comments  : defaults to 3.5
        See Also   : n/a

Version

       Bio::Tools::Sigcleave, $Id$

_Analyze

        Title     : _Analyze
        Usage     : N/A This is an internal method. Not meant to be called from outside
                  : the package
                  :
        Purpose   : calculates sigcleave score and amino acid position for the
                  : given protein sequence. The score reporting threshold can
                  : be adjusted by passing in the "threshold" parameter during
                  : object construction. If no threshold is passed in, the code
                  : defaults to reporting any scores equal to or above 3.5
                  :
        Returns   : nothing. results are added to the object
        Argument  : none.
        Throws    : nothing.
        Comments  : nothing.
       See Also   : n/a

See Also