Blast-Radius Aware AI Code Review for Business-Critical Systems
LiveReview LiveReview Explore LiveReview

freshservice_mcp

Integrates with Freshservice to manage IT service tickets and operations, enabling automated ticket creation, updates, and asset management.

Author

freshservice_mcp logo

effytech

MIT License

Quick Info

GitHub GitHub Stars 10
NPM Weekly Downloads 0
Tools 1
Last Updated 2026-02-19

Tags

freshservice_mcpfreshserviceeffytecheffytech freshservice_mcpfreshservice_mcp integratesservices effytech

Freshservice MCP Server

smithery badge

Overview

A powerful MCP (Model Control Protocol) server implementation that seamlessly integrates with Freshservice, enabling AI models to interact with Freshservice modules and perform various IT service management operations. This integration bridge empowers your AI assistants to manage and resolve IT service tickets, streamlining your support workflow.

Key Features

  • Enterprise-Grade Freshservice Integration: Direct, secure communication with Freshservice API endpoints
  • AI Model Compatibility: Enables Claude and other AI models to execute service desk operations through Freshservice
  • Automated ITSM Management: Efficiently handle ticket creation, updates, responses, and asset management
  • Workflow Acceleration: Reduce manual intervention in routine IT service tasks

Supported Freshservice Modules

This MCP server currently supports operations across a wide range of Freshservice modules:

  • Tickets
  • Conversations
  • Products
  • Requesters
  • Agents
  • Agent Groups
  • Requester Groups
  • Canned Responses
  • Canned Response Folders
  • Workspaces
  • Solution Categories
  • Solution Folders
  • Solution Articles

Components & Tools

The server provides a comprehensive toolkit for Freshservice operations:

Ticket Management

Tool Description Key Parameters
create_ticket Create new service tickets subject, description, source, priority, status, email
update_ticket Update existing tickets ticket_id, updates
delete_ticket Remove tickets ticket_id
search_tickets Find tickets matching criteria query
get_ticket_fields Retrieve ticket field definitions None
get_tickets List all tickets with pagination page, per_page
get_ticket Retrieve single ticket details ticket_id

Getting Started

Installing via Smithery

To install freshservice_mcp automatically via Smithery:

npx -y @smithery/cli install @effytech/freshservice_mcp --client claude

Prerequisites

  • A Freshservice account (sign up at freshservice.com)
  • Freshservice API key
  • uvx installed (pip install uv or brew install uv)

Configuration

  1. Generate your Freshservice API key from the admin panel:
  2. Navigate to Profile Settings → API Settings
  3. Copy your API key for configuration

  4. Set up your domain and authentication details as shown below

Usage with Claude Desktop

  1. Install Claude Desktop from the official website
  2. Add the following configuration to your claude_desktop_config.json:
"mcpServers": {
  "freshservice-mcp": {
    "command": "uvx",
    "args": [
        "freshservice-mcp"
    ],
    "env": {
      "FRESHSERVICE_APIKEY": "<YOUR_FRESHSERVICE_APIKEY>",
      "FRESHSERVICE_DOMAIN": "<YOUR_FRESHSERVICE_DOMAIN>"
    }
  }
}

Important: Replace <YOUR_FRESHSERVICE_APIKEY> with your actual API key and <YOUR_FRESHSERVICE_DOMAIN> with your domain (e.g., yourcompany.freshservice.com)

Example Operations

Once configured, you can ask Claude to perform operations like:

  • "Create a new incident ticket with subject 'Network connectivity issue in Marketing department' and description 'Users unable to connect to Wi-Fi in Marketing area', set priority to high"
  • "Update the status of change request #45678 to 'Approved'"
  • "List all critical incidents reported in the last 24 hours"
  • "Show asset details for laptop with asset tag 'LT-2023-087'"
  • "Create a change request for scheduled server maintenance next Tuesday at 2 AM"

Testing

For testing purposes, you can start the server manually:

uvx freshservice-mcp --env FRESHSERVICE_APIKEY=<your_api_key> --env FRESHSERVICE_DOMAIN=<your_domain>

Troubleshooting

  • Verify your Freshservice API key and domain are correct
  • Ensure proper network connectivity to Freshservice servers
  • Check API rate limits and quotas
  • Verify the uvx command is available in your PATH

License

This MCP server is licensed under the MIT License. See the LICENSE file in the project repository for full details.

Additional Resources


Built with ❤️ by effy

See Also

`