fasts3, fasts3_t - compare several short peptide sequences against a protein database using a modified
Contents
Description
fasts3 and tfasts3 are designed to compare set of (presumably non-contiguous) peptides to a protein
(fasts3) or translated DNA (tfasts3) database. fasts3/tfasts3 are designed particularly for short
peptide data from mass-spec analysis of protein digests. Unlike the traditional fasta3 search, which
uses a protein or DNA sequence, fasts3 and tfasts3 work with a query sequence of the form:
>tests from mgstm1
MLLE,
MILGYW,
MGADP,
MLCYNP
(included with the distribution), the result is:
testf MILGYW----------MLLE------------MGDAP-----------
:::::: :::: :::::
GT8.7 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEK
10 20 30 40 50
testf --------------------------------------------------
GT8.7 FKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIV
60 70 80 90 100
20
testf ------------MLCYNP
::::::
GT8.7 ENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAG
110 120 130 140 150
Environment Variables:
FASTLIBS
location of library choice file (-l FASTLIBS)
SMATRIX
default scoring matrix (-s SMATRIX)
SRCH_URL
the format string used to define the option to re-search the database.
REF_URL
the format string used to define the option to lookup the library sequence in entrez, or some
other database.
Name
fasts3, fasts3_t - compare several short peptide sequences against a protein database using a modified
fasta algorithm.
tfasts3, tfasts3_t - compare short pepides against a translated DNA database.
Options
fasts3 and tfasts3 can accept a query sequence from the unix "stdin" data stream. This makes it much
easier to use fasta3 and its relatives as part of a WWW page. To indicate that stdin is to be used, use
"-" or "@" as the query sequence file name.
-b # number of best scores to show (must be < -E cutoff)
-d # number of best alignments to show ( must be < -E cutoff)
-D turn on debugging mode. Enables checks on sequence alphabet that cause problems with tfastx3,
tfasty3, tfasta3.
-E # Expectation value limit for displaying scores and alignments. Expectation values for fasts3 and
tfasts3 are not as accurate as those for the other fasta3 programs.
-H turn off histogram display
-i compare against only the reverse complement of the library sequence.
-L report long sequence description in alignments
-m 0,1,2,3,4,5,6,9,10
alignment display options
-N # break long library sequences into blocks of # residues. Useful for bacterial genomes, which have
only one sequence entry. -N 2000 works well for well for bacterial genomes.
-O file
send output to file
-q/-Q quiet option; do not prompt for input
-R file
save all scores to statistics file
-S # offset substitution matrix values by a constant #
-s name
specify substitution matrix. BLOSUM50 is used by default; PAM250, PAM120, and BLOSUM62 can be
specified by setting -s P120, P250, or BL62. With this version, many more scoring matrices are
available, including BLOSUM80 (BL80), and MDM_10, MDM_20, MDM_40 (M10, M20, M40). Alternatively,
BLASTP1.4 format scoring matrix files can be specified.
-T # (threaded, parallel only) number of threads or workers to use (set by default to 4 at compile
time).
-t # Translation table - tfasts3 can use the BLAST tranlation tables. See
http://www.ncbi.nih.gov/htbin-post/Taxonomy/wprintgc?mode=c/.
-w # line width for similarity score, sequence alignment, output.
-x "#,#"
offsets query, library sequence for numbering alignments
-z # Specify statistical calculation. Default is -z 1, which uses regression against the length of the
library sequence. -z 0 disables statistics. -z 2 uses the ln() length correction. -z 3 uses
Altschul and Gish's statistical estimates for specific protein BLOSUM scoring matrices and gap
penalties. -z 4: an alternate regression method.
-Z db_size
Set the apparent database size used for expectation value calculations.
-3 (TFASTS3 only) use only forward frame translations
